(data stored in ACNUC1104 zone)

EMBL: FN667741.PE375

FN667741.PE375       Location/Qualifiers
FT   CDS_pept        393448..394236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0077"
FT                   /locus_tag="XBJ1_0380"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79530"
FT                   /db_xref="GOA:D3UZ02"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79530.1"
FT                   /translation="MERSLAGKAVIITGAGSGIGLAATTEFLNAGAYVIGADINLEKLY
FT                   ELQRGEYLFPYQFNVRDPSDIDGLINTAISQFGKIDILINNAALVEPRKSFLDVTDDDW
FT                   NSTIETNLLGYIRMARGVLPYMCNQKKGILLHIASEAALMPNLILPDYSILKSSVLTLS
FT                   KVISREFGKYGIRSNVISPAFIHTSIYDKPEGLITQLEQKYKVGREEALQRYIEEVDIA
FT                   VGRLGQPEEVAVLLLFLASESAAFITGANYLVDGGVTPFI"
     atggagcgta gtttagcggg taaagcagta atcatcactg gggcaggttc aggtattggg        60
     cttgctgcta ccacggaatt tttaaatgcg ggggcgtatg ttataggagc ggatattaac       120
     cttgagaaac tttatgagtt gcagagaggg gaatacctat ttccttatca gtttaatgtc       180
     agagatccct cagatattga tggtcttatc aatacagcca tcagccaatt tgggaagata       240
     gatatcctga ttaataatgc tgcattagta gaaccgagga aaagttttct tgatgtaacc       300
     gatgacgact ggaattctac aatcgaaacc aatctgcttg gttacatccg aatggctcgc       360
     ggtgtactac cttatatgtg caatcagaaa aagggtattt tactccatat cgcttctgaa       420
     gcagcattaa tgccaaattt gattctccct gattacagta tcttgaaatc ttcagttcta       480
     actctgtcta aggtgatatc aagggagttt ggaaaatatg gcattcgatc taatgttatt       540
     tctccagctt ttattcatac ctctatctac gataaacctg aaggattgat aactcagctt       600
     gaacaaaagt ataaagttgg acgtgaagaa gcattgcaac gttatattga agaagttgat       660
     atcgctgttg gtcggttagg gcaacctgaa gaagtggcgg ttttactctt atttttggcc       720
     tcagaatctg ctgcattcat tactggggca aattatttag tcgatggcgg agtgactcct       780
     tttatctaa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page