(data stored in ACNUC1104 zone)

EMBL: FN667741.PE376

FN667741.PE376       Location/Qualifiers
FT   CDS_pept        394291..395076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0077"
FT                   /locus_tag="XBJ1_0381"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79531"
FT                   /db_xref="GOA:D3UZ03"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79531.1"
FT                   /translation="MNINLKGKIALVTGSTAGIGLAIAQGMHKAGASVILNGRSEERLI
FT                   QAVNKFNCLDRVFTVAADVGTKEGCELINKNFPDIDILVNNAGIFSPKPIFEISDDEWI
FT                   NYFNINVLSGIRLARSYIPLMIGKRWGRVVFISSESALQIPVEMPHYGLTKTAQVAAAR
FT                   GFAQAATGTGVTVNSVLPGPTESEGVERFVRELITDPTLSMEEAGKRFIETARPASLLG
FT                   RLATAEEVANAVLFLASPLASAITGTALRVDGGVIQSIL"
     atgaatataa atttaaaagg gaaaattgca ttagtaacag gttctacagc agggattgga        60
     ttagctattg ctcagggtat gcataaggct ggtgcttctg tcattttgaa tggaagaagt       120
     gaagagaggc tcatacaggc ggttaataaa tttaactgct tggatcgcgt ttttactgta       180
     gctgctgatg ttggcaccaa agaaggctgt gaactcatta acaaaaattt tccggatatt       240
     gatattctgg ttaataacgc cggaattttt tctcctaagc caatttttga aattagcgat       300
     gatgaatgga ttaattattt taatattaat gtcctaagtg gaattcgtct ggcacgttca       360
     tacattccac ttatgattgg gaaacgatgg ggacgtgtgg tattcatctc aagtgagtca       420
     gccttacaaa tcccggtaga aatgccacat tatggcctga ccaagacggc tcaagtcgca       480
     gcagcaagag gattcgcaca agctgctaca ggaacaggag tcactgtcaa cagcgtttta       540
     cctggaccca ctgaaagtga aggggtagag cgatttgtca gagaacttat cacggaccca       600
     acactttcaa tggaagaagc aggaaaacgc tttattgaaa cagcacgtcc cgcatcgttg       660
     ctgggtcggt tagccactgc tgaagaagtc gccaatgctg ttctcttttt agcttcacca       720
     ctcgcttctg caataacggg tactgccctg cgtgttgatg gtggcgtcat tcaaagtatt       780
     ttgtaa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page