(data stored in ACNUC1104 zone)

EMBL: FN667741.PE377

FN667741.PE377       Location/Qualifiers
FT   CDS_pept        complement(395125..396033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0382"
FT                   /product="Regulatory protein, LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79532"
FT                   /db_xref="GOA:D3UZ04"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79532.1"
FT                   /translation="MVLRNLEDLSVFIRIIDTGSFTATAQALGLSPTTVSKQIARLEKN
FT                   LGVVLFVRSTRSLRITPEGKAIAEKVRAALTLVEEATEIAKDGSESLTGLIRLTAPVPL
FT                   GRTYVAAAIAEFRKKYPSVGFILHLTDKIVDLYKVEMDLAIRVANLTDSGLIARRLTDN
FT                   KRILVASPDYLRLHGELQHPEELINHHCLLFSASGNKSTIWSLHDRKGTKAISLSSDLI
FT                   ANNGDVLRTWCTAGLGIALRETWDVVDLIRAKKLIQILPEWQEETSPINLVRAGKRPVP
FT                   QRIKSFIEFLTEEWRIPPWEK"
     gtggtacttc gtaaccttga agatctaagt gtatttatca gaatcatcga cacaggcagt        60
     ttcactgcta ccgctcaagc cttgggactg tctcccacca ctgtcagtaa acagattgca       120
     cgtctggaga aaaatcttgg cgtagttctc tttgtacgaa gtacccgttc attgcgcatt       180
     actcctgaag gcaaagcaat cgctgaaaaa gtgagggcgg cgctgacact ggtggaagaa       240
     gcgactgaaa ttgccaagga tggaagtgaa tctctcacag gtttgattag acttaccgcg       300
     ccagtaccgc ttggtcgaac ttatgtcgcg gcagcaattg cagagtttag aaaaaaatat       360
     ccatcagtag gattcatctt gcatttgaca gataaaattg ttgatcttta taaagttgag       420
     atggatttag ctatcagagt cgcaaattta actgattcag gtttaattgc cagacgctta       480
     acagataaca aacgaatttt agtcgcatca cctgattacc tcagactgca tggcgaactt       540
     cagcacccag aagagctgat taaccatcat tgcctgcttt tttccgcctc cggaaataag       600
     agtacaatat ggtcactaca cgataggaaa ggcactaaag ctatctcact ctcaagtgat       660
     ttaatcgcta ataatggtga tgtcttgcga acttggtgta cggcaggttt aggtatagca       720
     ctgcgagaaa catgggatgt agtcgattta attcgcgcaa aaaaactcat ccagatactg       780
     ccggaatggc aagaagaaac ctcgccaatt aatctagtga gagccgggaa acggcctgtt       840
     ccgcagcgta tcaaaagctt catcgagttt ctcaccgagg aatggagaat tcccccgtgg       900
     gaaaaatag                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page