(data stored in ACNUC1104 zone)

EMBL: FN667741.PE379

FN667741.PE379       Location/Qualifiers
FT   CDS_pept        397422..397634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79534"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79534.1"
FT                   /translation="MEICYIASMRNCVIFHFVSGIFSNEIYKIKSLFVFIIYLNDFTNS
FT                   DYYIFNSDAVFNISITFVCDLYLKF"
     gtggaaatct gttacatcgc gtcaatgagg aattgcgtaa tattccattt cgtatcagga        60
     attttttcta atgaaattta taaaataaag tcattatttg tttttattat ttatttaaat       120
     gatttcacta attctgatta ttatatattt aatagtgatg ctgtttttaa tataagcatt       180
     acatttgttt gtgatctgta tcttaaattt taa                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page