(data stored in ACNUC1104 zone)

EMBL: FN667741.PE385

FN667741.PE385       Location/Qualifiers
FT   CDS_pept        401536..401787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0390"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79540"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79540.1"
FT                   /translation="MKSVKYIVCILALSAISFGSMAATEVQYAKGEKVGVVSVTGAETL
FT                   DSLTAELSKKADKAGASYFRVISANGQNKLSGVAEIYK"
     atgaaatctg taaaatatat cgtctgtatt ttggcattaa gtgctatttc atttggctct        60
     atggctgcaa ctgaagtgca atatgctaaa ggagagaagg ttggggttgt ttcagttact       120
     ggtgcagaga cactggatag tctgactgct gagttatcca aaaaagctga taaagcgggt       180
     gcatcatatt tccgtgttat ttcagcaaat ggtcagaata aactcagtgg agttgctgaa       240
     atctataaat aa                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page