(data stored in ACNUC1104 zone)

EMBL: FN667741.PE386

FN667741.PE386       Location/Qualifiers
FT   CDS_pept        401904..402335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79541"
FT                   /db_xref="GOA:D3UZ13"
FT                   /db_xref="InterPro:IPR011194"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79541.1"
FT                   /translation="MELNENFLTIRRYLAKQHVFTLCTSSSQDLWCASCFYAFDADSMA
FT                   FWFMTEPDTRHGQMMQQNPVVAGTVAGQTRNIAQIKGIQFRGEITPLTGEAETLARARY
FT                   CRRFPVALAAKSPIWRLSLSEIKMVDNTLGFGKKLHWQR"
     atggaattaa atgaaaattt cttaactatt cgtcgatatc tcgccaaaca acatgtcttc        60
     actctctgca cttcctcatc acaagatcta tggtgtgcga gttgcttcta tgcgtttgat       120
     gccgatagta tggcattctg gtttatgacc gaaccggata cccgccacgg ccagatgatg       180
     cagcaaaatc cagtagttgc cggcactgtc gcagggcaaa cccgtaacat tgcccaaatc       240
     aaaggtattc aattccgtgg tgaaatcaca ccgctgacag gcgaagccga aactcttgcc       300
     agagcacgtt attgccgtcg ttttcccgtc gccctcgctg caaaatcccc tatctggcga       360
     ctcagcctaa gtgaaataaa aatggtggat aacacccttg gttttggcaa aaaactacat       420
     tggcaacgtt aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page