(data stored in ACNUC1104 zone)

EMBL: FN667741.PE391

FN667741.PE391       Location/Qualifiers
FT   CDS_pept        404682..405899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0080"
FT                   /locus_tag="XBJ1_0396"
FT                   /product="YjcL protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79546"
FT                   /db_xref="GOA:D3UZ18"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79546.1"
FT                   /translation="MNNTLITSDNSLMLWAFIMIAVAVAIMVEQRYRWASKIPGAVIAL
FT                   IIAVFASNLNIIPTEAPVYDAVWGYIVPLAIPLLLFKTNLHSIIKESWRLLILFLISSV
FT                   ATMIGAIVSFRLFKEHIPELDKISGMISASYTGGGVNFAAMAAKLEPSQSMTASTIVAD
FT                   NMMMAGYFIILIALSGWTVARKFWGSPHTDAIDNDPDLDKSQTFAAAYWKPKNIALKDI
FT                   ALSLAWSIFIVALSFQLSTWLKALLGQPNSIYQELLFSLISDKYLILTTVTFTLVSIFK
FT                   ETFSKLNGTQELGTYAIYMFFVVIGIPASIEAIISHAPLLFAFVFVIAMINLLLTFAAG
FT                   KVFKFSLEENILACNANIGGPTTAAAMAISRGWVNLVGPIMVIGTVGYVIGNYVGTFVY
FT                   FIVGRM"
     atgaacaata ctttaattac ctctgataat tcattaatgc tttgggcctt tattatgatt        60
     gcggttgctg tggcaattat ggtagagcag cgataccgat gggcatctaa aatacccggt       120
     gcagttatcg cactgatcat tgcagtattc gcgtctaact taaatatcat tccgacagaa       180
     gctcctgttt acgatgcagt ttggggatat atcgtgccat tagcaatccc cttgctgtta       240
     ttcaaaacca atttacacag tattatcaaa gaaagctggc gattactgat cttatttttg       300
     atttcttccg ttgccacgat gattggcgcg atagtttctt tccggctttt taaggagcat       360
     atcccggaac tggataaaat cagcggtatg atttcggctt catatacagg aggtggggtc       420
     aactttgcgg caatggccgc caaactggaa ccttcccaaa gtatgacggc atccactatc       480
     gtggccgata atatgatgat ggcaggttac tttattatcc tgatagcatt atctggctgg       540
     acagtagcca ggaagttctg gggcagtcct catactgacg cgatagataa cgatccagac       600
     ttggataaat cccagacttt tgcagccgct tattggaagc cgaaaaatat cgctctgaaa       660
     gatatcgcct tatcgctggc atggtcgatt tttatcgttg cgctgtcatt tcagttatct       720
     acatggctaa aagccctgct ggggcaacca aacagtattt atcaggaact gcttttcagt       780
     ttgatatccg ataaatacct gatccttaca actgtgacgt ttactctcgt ctcgatcttt       840
     aaagaaacat tcagcaaact gaatggcaca caggaattgg ggacttacgc tatttatatg       900
     ttctttgtcg tgattggcat tccggcatca attgaagcca tcattagcca tgcaccactg       960
     ctgtttgctt ttgtttttgt aattgccatg atcaacctgt tactgacctt tgctgcggga      1020
     aaagtgttta aatttagtct ggaagagaac attctggcct gtaacgccaa tatcgggggg      1080
     ccaacaacgg cagccgctat ggcaattagc cgcggctggg tcaatctggt cggcccgatt      1140
     atggtgattg gtacagtcgg ttatgtgatt ggcaactatg tggggacttt tgtgtacttt      1200
     attgtggggc ggatgtaa                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page