(data stored in ACNUC1104 zone)

EMBL: FN667741.PE398

FN667741.PE398       Location/Qualifiers
FT   CDS_pept        complement(412776..413219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0403"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79553"
FT                   /db_xref="GOA:D3UZ25"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79553.1"
FT                   /translation="MLNGTQLRYAALIARYSLAIAYLVAVADRFGLCGEYGDPQITWGN
FT                   FTVFLGVVKHLTPWAPDFMIPIFGWGATILEVALPIFLIIGFKIKETALVSAALLLIFA
FT                   VTMTTTGLLKSVFDYSVLSAFSCSLLLYCFEKFRVSEDKKQLN"
     atgttaaacg gaactcaatt aagatacgcg gctttaatcg cacgttattc acttgcgatt        60
     gcatatctgg tcgcagtagc tgacagattt ggtttatgtg gtgaatatgg agatccacag       120
     attacgtggg gtaatttcac ggtattcctt ggcgttgtta agcatttgac cccttgggca       180
     cccgatttta tgatccctat ttttggttgg ggagccacta ttcttgaagt tgctctaccc       240
     atattcctaa taataggttt taaaatcaaa gaaaccgctt tagtcagcgc agccttgttg       300
     ttaatttttg ctgttacaat gacaacgact ggcttactta aaagcgtgtt tgactatagc       360
     gttttatctg cattttcctg ttcacttcta ctctactgtt ttgaaaaatt cagagtgagt       420
     gaagataaaa agcaattaaa ttaa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page