(data stored in ACNUC1104 zone)

EMBL: FN667741.PE402

FN667741.PE402       Location/Qualifiers
FT   CDS_pept        complement(416387..417118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0081"
FT                   /locus_tag="XBJ1_0407"
FT                   /product="putative oxidoreductase, NAD(P)-binding domain"
FT                   /EC_number="1.1.1.184"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79557"
FT                   /db_xref="GOA:D3UZ29"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79557.1"
FT                   /translation="MKTCLITGANRGIGFEIAKKLGERGHRVILSGRDIPALEHSVSQL
FT                   TQMGITADLLHLDVTDPESIKSAANLLLSANTTLDVLINNAGVFLDSIQKPSETSLDDI
FT                   HKSLTVNLVGPWLVTQAFLPLLNRSEEARLIFISTDLAALSQAADPHSKYNRIEGPAYR
FT                   ASKAALNMLALQWAKEFRDSKISVSVCSPGWCRTGLDSQISSEQAPNSAAEGADTVVWL
FT                   ALDKGREQHGHFYSARQTIDW"
     atgaaaactt gcttaattac gggtgccaac agaggcatcg gatttgaaat tgcgaaaaaa        60
     ttgggtgaac gaggccatcg ggtaatactt tcaggccgtg atatacctgc gcttgaacat       120
     agtgtttcac aattgaccca aatgggaata accgccgatt tgcttcattt ggatgtcaca       180
     gatccagaat ccataaaatc tgcggcaaat ttactgctca gcgccaatac gacccttgat       240
     gtactgatta ataatgctgg tgtttttctg gattcaatcc aaaaacccag cgaaacctct       300
     ctggatgaca tccataaaag tctgacggtc aatttggttg gcccctggct cgtcacccaa       360
     gcatttttac ccttactcaa tcgttcagaa gaagctcgac tcatttttat atctaccgat       420
     cttgccgcgt tatcccaagc tgctgacccg cattcaaaat ataacagaat cgaaggtcca       480
     gcttatcgag cctccaaagc cgctctgaac atgctcgcgt tacaatgggc gaaagaattt       540
     cgtgattcga agatttctgt cagtgtatgc agcccgggtt ggtgcagaac gggcttagat       600
     agccaaatta gttcagaaca ggcaccaaat tctgctgccg aaggtgctga tacggttgtt       660
     tggctggcct tagataaggg cagagaacaa cacggccatt tttattcagc tcgccagact       720
     attgattggt aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page