(data stored in ACNUC1104 zone)

EMBL: FN667741.PE407

FN667741.PE407       Location/Qualifiers
FT   CDS_pept        complement(422588..423808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0082"
FT                   /locus_tag="XBJ1_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79562"
FT                   /db_xref="GOA:D3UZ34"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79562.1"
FT                   /translation="MNSIIKTDIKESMYNIFTENTDNIWSDWLDEKELKKLTDHPVLQS
FT                   FNDSTASEEMLKTFLIQHCYYSRHFTRYLIALISKLDVFEDIKDLLHNLLEEMGLEDEN
FT                   KITHAELFQRTLKTVGADINSQKPFENTTAMVDAMFSFCLSDDPLEGLSAMCLGAEAIV
FT                   PLIYKPVLNRLMTLNYNKDATEFFTLHIEEDEDHAIKMFEIIDRLTRQDESLRLKAINI
FT                   GSEMIRKRVKMLDSVWESEIVRKNNVEKADLNNQKNDLSFNSSDFWRVNHKSTPSIPEK
FT                   LIHKNVINSHSHGENKFSEERKHKVNIVNLPTKTISMTLGHLEPGQSTNLHRHNYETVI
FT                   YIIEGDGVSKIGNNDVAWSAGDAIYIPSWVEHKHSSVNQNQCLYIACENAPLLQNIGNI
FT                   ALREELE"
     atgaattcaa tcataaaaac agatattaaa gaaagtatgt ataatatttt tacagaaaac        60
     acagataata tctggtctga ctggcttgat gaaaaagaat taaaaaagct gacagatcac       120
     cctgtactcc agtcatttaa tgatagtaca gctagtgaag aaatgttaaa aacattccta       180
     attcaacatt gctactattc tcgtcatttt acacgttatt taatcgcgct tataagtaaa       240
     ttagacgtat ttgaagatat aaaagatctt cttcacaatt tactggaaga aatgggatta       300
     gaggatgaaa acaaaatcac tcatgctgag ctttttcaga gaacattgaa gactgtcggt       360
     gctgatatca atagtcaaaa accttttgaa aatacaaccg ctatggttga cgctatgttt       420
     tctttctgtc tttcagatga tccgttagag gggctgtcag ccatgtgcct tggcgcagaa       480
     gctatcgttc ccttaattta taagcccgta ttaaatcgtt taatgacatt gaattacaat       540
     aaggatgcaa cagaattctt cacactccat attgaagaag atgaagatca tgctattaaa       600
     atgtttgaga tcatagatag actcactagg caggacgaat cattacgcct caaagccatc       660
     aatattggca gtgaaatgat aagaaaacgc gtcaaaatgc tggatagtgt ctgggaaagt       720
     gaaattgttc gtaagaacaa tgtagaaaag gccgacttaa ataatcaaaa aaatgatctt       780
     tcctttaatt cttctgattt ttggcgtgtc aaccacaaat caacaccttc tattcctgag       840
     aaactaattc ataaaaacgt cattaacagt catagtcatg gtgaaaataa attttcagaa       900
     gaaagaaaac ataaagtcaa tatcgtcaat ttgcccacta aaacaatcag tatgacatta       960
     ggtcatcttg aacccggaca atcgacgaat ctgcaccgac ataattatga aactgtcatc      1020
     tatatcattg aaggggatgg cgtatcaaaa ataggaaata atgatgttgc ttggtcagca      1080
     ggagatgcca tttatatccc atcctgggta gaacataaac atagcagtgt gaatcagaat      1140
     caatgccttt atattgcttg tgaaaatgct cctttattac aaaatattgg taacatcgca      1200
     cttcgtgaag aattagaata a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page