(data stored in ACNUC1104 zone)

EMBL: FN667741.PE411

FN667741.PE411       Location/Qualifiers
FT   CDS_pept        427353..428927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0084"
FT                   /locus_tag="XBJ1_0416"
FT                   /product="Band 7 protein (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79566"
FT                   /db_xref="GOA:D3UZ38"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79566.1"
FT                   /translation="MMKKIKLLQGQIGLLAKEGEYQQILTAGKYRFIDWFNKLRLTVFE
FT                   LNSNEIEAKLAEHLRQYHTDWVAQHCDDIQLTEDEIGLLYEHDLLTEILPPATRRLYWK
FT                   NGDQRRIEVCPTTEQEVSSQLVSLLQPSKIRKRNVKGLESVLITQIPAWHIGVLKSDGI
FT                   VQQLLQPGLKGYWRFGHDISVELVDTRSWPQVEESLAEYFRHQHIDWVEQYCDEIQIAD
FT                   DEMGLLYEHDVLVEILSPATRYLYWKNGNPRCVEVLKASELEVSSELASVLVSSMVRKH
FT                   SVKGIDSVLIAQVPAWHVGILKVDGVAQKLLQPGQAGYWQVGHDVTVEIVDTRLQALEV
FT                   GGQEILTRDKVNLRINLSANWRYHDVLMAYEQLSEPVAYLYRELQFALREMVGTRSLDE
FT                   LLEDKQAIDELINEKVQRITAGFGLEVVSLGVKDIILPGEMKTILSRVVEAEKAAQANV
FT                   IRRREETAATRSLLNTAKVMENNPIALRLKELETLESIAERINQISVYGGLDQVLNGLV
FT                   QIKGEQK"
     atgatgaaaa aaatcaaatt attgcaggga caaattggct tactggcaaa agagggtgaa        60
     taccaacaga ttttaacggc gggtaaatat cgtttcatcg attggtttaa caagctgaga       120
     ctgacggtat ttgaacttaa tagcaacgaa attgaagcaa aactggcaga acacttgcgc       180
     cagtaccata cggattgggt tgctcagcat tgtgatgata ttcagcttac tgaagatgag       240
     atcgggctgc tgtatgaaca tgatttactg accgaaatcc tgccaccagc gacgcgtcgt       300
     ttatattgga aaaacggtga tcagcgccgg attgaagtat gcccaaccac ggaacaagag       360
     gtttcctcac agttggtttc tctattacag ccttcaaaga tacgtaaacg caatgtgaag       420
     ggattggaaa gtgtgctgat tactcaaatt ccggcatggc atatcggagt tttgaaaagc       480
     gatggcatcg tgcagcagtt gttgcagcca ggcctaaaag gttattggcg ctttggtcac       540
     gatatttctg tagagcttgt cgatactcgt tcatggccac aagttgaaga aagtttggcg       600
     gagtattttc gccatcagca tattgattgg gtagaacagt attgtgatga aatccagatt       660
     gctgatgatg agatggggct gctgtatgaa cacgacgtat tggtggaaat tctatccccc       720
     gcgacccgct acttatattg gaagaacggt aatccacgtt gcgttgaggt acttaaggcc       780
     tcggaactgg aggtttcctc cgagctagct tctgtgctgg tgtcttctat ggtgcgtaaa       840
     catagcgtga aaggcataga tagcgtattg attgctcaag ttccagcgtg gcatgtcggc       900
     attttgaaag ttgatggcgt ggcgcagaag ttattgcagc ccggccaggc gggttattgg       960
     caagttggtc atgatgtgac ggttgaaatt gtcgataccc gattacaggc attggaggtg      1020
     ggtgggcagg aaattttgac ccgggacaaa gtgaacttgc gcattaattt atctgctaac      1080
     tggcgttatc acgacgtgct gatggcttac gagcaattga gcgagccagt ggcatatctg      1140
     taccgcgaac tgcaatttgc tttgcgtgaa atggtgggaa cccgttcatt ggatgaattg      1200
     ctggaagata aacaggcgat tgatgaactg ataaatgaaa aagtccagcg gataacagcg      1260
     ggttttggtt tagaagtggt ctctctcggt gtaaaagaca ttattttacc cggcgagatg      1320
     aagactattc tgtcgcgggt agtagaagca gagaaagcag cacaggccaa tgtgatccgc      1380
     cgtcgtgaag aaactgcggc gacccgttca ctgttgaata ccgcgaaagt gatggaaaac      1440
     aacccgattg ctctgcgttt gaaagagctg gaaacactgg aaagcatcgc tgaacgaatc      1500
     aatcaaattt cggtatatgg cggtttagat caagttctga atggactggt acaaattaaa      1560
     ggagaacaaa aatga                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page