(data stored in ACNUC1104 zone)

EMBL: FN667741.PE413

FN667741.PE413       Location/Qualifiers
FT   CDS_pept        430183..430989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0084"
FT                   /locus_tag="XBJ1_0418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79568"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79568.1"
FT                   /translation="MEVMEKKTTAVSSVMRTRIKQELAGIEKRYGVQILYACESGSRGW
FT                   GFASPDSDYDVRFIYVHPVDWYLIVEAGRDVIELPISDELDICGWELRKTLKLLKQANP
FT                   TLMEWLDSPIIYQADPAATNGLKTMVPHFFSGIKARYHYLSMAKKNFRGYLQGEEVRLK
FT                   KYFYVLRPLLAVRWIEMGKGVPPIDFETLVAGTVDDPQLKAEISDLLRSKRLANESEYG
FT                   LRKLRVHAFIESELDETLSRCELKDKRERSYALLDDYLRRWVMKRV"
     atggaagtaa tggaaaagaa aacaacagca gttagctctg tcatgcgtac ccgtatcaaa        60
     caggaattgg ctggcataga gaaaaggtat ggcgtgcaga tactgtacgc ctgtgaatcc       120
     ggcagtcgtg ggtggggctt tgcctcaccc gacagtgatt acgatgtgcg gtttatttat       180
     gtccatcccg tggattggta tctcattgta gaagcagggc gggatgtgat cgaactgccg       240
     atcagcgatg agctggatat ctgcgggtgg gaactgcgta agacactaaa gttactgaaa       300
     caggcgaatc caactttaat ggaatggtta gattcgccaa ttatttatca ggcagatccg       360
     gccgctacca atggattaaa aacgatggtg ccgcatttct tttcgggtat caaagcgcgc       420
     taccactatc tttcgatggc aaagaaaaac tttcgaggtt atctgcaagg tgaagaagtt       480
     cggctaaaaa aatactttta cgtattgcgc ccattacttg ctgttcgctg gattgagatg       540
     gggaagggcg taccgccgat tgattttgaa acgctggtgg caggtacagt cgatgatcct       600
     caattgaaag cggaaattag tgatctattg cggagtaaaa gattagcgaa tgagtcagaa       660
     tatggcctgc gtaagctgag ggttcacgcc tttattgaat cagaacttga tgaaacattg       720
     tctcgttgcg aactcaagga taagcgtgaa cgcagctatg cactactgga tgattattta       780
     aggcgttggg tgatgaagcg agtataa                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page