(data stored in ACNUC1104 zone)

EMBL: FN667741.PE418

FN667741.PE418       Location/Qualifiers
FT   CDS_pept        complement(433048..433302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79573"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79573.1"
FT                   /translation="MSGVGLHSIAGVVEQISDPILGGGSFRSNGAVKALIELDVILQGP
FT                   KIGRNHSYRLNPQFGWKGMVNNHKETLTNGLSVIQGGRA"
     atgtcaggag tcggcttgca ctcgattgct ggagttgtgg aacaaatatc tgacccgatt        60
     ttgggaggtg ggagtttcag gagcaacgga gcagtaaagg cgctcatcga acttgatgtg       120
     atattgcaag gacccaaaat cgggcgtaat cacagttacc gtttaaaccc tcagttcggc       180
     tggaaaggta tggtaaataa tcataaagaa actcttacca atggcctgag tgtaattcag       240
     ggcggccgtg cttaa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page