(data stored in ACNUC1104 zone)

EMBL: FN667741.PE430

FN667741.PE430       Location/Qualifiers
FT   CDS_pept        complement(442204..442977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0435"
FT                   /product="putative cysteine transport protein (ABC
FT                   superfamily, peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79585"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79585.1"
FT                   /translation="MNIILNILLATIIQLGITQLAYAKSTLDNIQSTGVFRIGTEGAYA
FT                   PFSYHDASGKLTGFDVEIGREIALRMKVKPEFIEGKWDGLIGGLDAGRSDAVMNQIAIT
FT                   PEREKKYSFSLPYVISEAVLITRKDNNDIKTFRDLKGRTSSHTLTNNFAQIARHYGAEI
FT                   IGTNGFSQEVELVSTGRADATINDKLSYLDYKKHRPDAPVKIVAADTNAAQTAVLLRKS
FT                   DPELKAAVDKAITEIKNDGTYQQIWDNYFGGEVAE"
     atgaatataa ttctgaatat actactggca actatcatcc aattaggcat cacccaactg        60
     gcttatgcaa agtccactct tgataatatc caatccacag gtgtattcag aatcgggaca       120
     gaaggagcct atgcgccctt cagttatcat gatgcttccg gcaagttaac cggttttgat       180
     gtggaaattg gtcgcgaaat tgctctgcgt atgaaagtaa aacccgaatt tattgaaggc       240
     aagtgggatg gtttgattgg tggccttgat gccggacgtt ccgatgccgt catgaatcaa       300
     attgctatta caccagaacg cgagaaaaaa tatagctttt ccctgcccta tgtcatttct       360
     gaggctgtgc tgattacccg aaaagataat aacgacatta aaactttcag ggatttaaaa       420
     ggcagaacct cctcccatac cctgactaat aactttgccc agattgcccg ccattatggt       480
     gcagaaatta tcggaaccaa tggctttagt caggaagtgg aattggtcag cacaggtcgg       540
     gcagatgcca ctatcaatga taaactttct tatctcgact ataaaaaaca tcgcccggat       600
     gcaccggtaa aaattgtagc ggccgatacc aacgcagcac aaaccgccgt gctgctgcgt       660
     aaaagtgatc ctgaattaaa agccgctgtt gataaagcca ttactgaaat taaaaacgat       720
     ggcacttatc agcagatttg ggataattat tttggcggag aggtggctga ataa             774
//

If you have problems or comments...

PBIL Back to PBIL home page