(data stored in ACNUC1104 zone)

EMBL: FN667741.PE431

FN667741.PE431       Location/Qualifiers
FT   CDS_pept        443302..443469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0436"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79586"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79586.1"
FT                   /translation="MNNLLSIMSFYSKTFMAISFIFQVAAAMQPEIYRVYIADIKFVDY
FT                   STNLNIGAKC"
     atgaataact tattgagtat tatgtcattt tatagtaaaa cctttatggc catatccttc        60
     atctttcagg ttgctgccgc gatgcaaccc gaaatctatc gggtatatat tgctgatata       120
     aaattcgtcg attattctac aaatttaaat ataggtgcca agtgctga                    168
//

If you have problems or comments...

PBIL Back to PBIL home page