(data stored in ACNUC1104 zone)

EMBL: FN667741.PE433

FN667741.PE433       Location/Qualifiers
FT   CDS_pept        444188..444499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0086"
FT                   /locus_tag="XBJ1_0438"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79588"
FT                   /db_xref="GOA:D3UW79"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79588.1"
FT                   /translation="MGLISFLLRVTPFLMNNNKSFKADSLFITSLDYAICFIIGTIIVN
FT                   ISLNNLSLSELINQFNINYFISLVTIVLAYFISKYMCSILKILFFSLVFFIVIHWLLR"
     atgggattaa ttagtttctt attgagagtg actccatttt tgatgaataa caataaatca        60
     ttcaaagccg atagtttgtt tattacatcg ttggattatg ctatttgttt tattattgga       120
     actattatcg tcaatatttc cttgaataat ttatcactaa gtgaattaat taatcagttt       180
     aatattaatt attttatttc tttagtcacg attgttttgg catatttcat cagcaaatat       240
     atgtgttcaa tattaaaaat cctgtttttt tcgctggtat tttttatcgt tattcattgg       300
     ctgttgcgtt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page