(data stored in ACNUC1104 zone)

EMBL: FN667741.PE447

FN667741.PE447       Location/Qualifiers
FT   CDS_pept        455172..456134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79602"
FT                   /db_xref="GOA:D3UW93"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79602.1"
FT                   /translation="MRVQLRVTFEVVARDWHASNQKWSASHSARVLKSLEDNIFAAIGK
FT                   RNIAELKTRDLLVPIKAVESSGRLEVAARLQQRTTAIMRFAVQSGLIDYNPAQEIAGAV
FT                   ATAKRQHRAALELNRIPELLHHIDHYSGRPLTRLAVELTLLVFIRSSELRFARWSEVDF
FT                   EKAMWTIPGEREPLEGVKHSQRGSKMRTPHLVPLSQQALAILEKIKSMNGNRELIFVGD
FT                   HDPRKPMSENTVNKALRVMGYDTKTEVCGHDFITLQSAGNTDLDNLERNIQGKIQHTDN
FT                   PRELVATELALNLLTEQIASSDVLSGSHLWWFKRNEPLC"
     atgcgggtac aactgcgggt aacgtttgaa gtggttgcca gagactggca cgccagcaat        60
     cagaaatggt cggcatcgca tagcgctcgt gtattgaaaa gtctcgaaga taatatcttc       120
     gctgctatcg gtaagcggaa cattgcagaa ctgaaaacgc gagacctact tgtacccatc       180
     aaagcagtcg agtcatccgg acgccttgaa gtcgccgccc gtttacagca gcgtactacc       240
     gcgattatgc gctttgccgt tcagagcggc ttaatcgact ataaccctgc gcaagagatt       300
     gccggtgcgg ttgctacagc gaaaagacag catcgtgctg ctctggaact taatcgcatt       360
     cctgaattac ttcaccacat cgatcactat tctggcaggc cgttaactcg actggcagtt       420
     gaactcactt tgttggtttt catccgttca agcgagctgc gttttgcccg ctggtcagaa       480
     gtggattttg aaaaggctat gtggacgatt ccaggtgagc gtgaaccact tgaaggtgtt       540
     aagcattctc aacgtggttc gaagatgcgg actcctcatc ttgttccctt gtcgcaacag       600
     gctctagcaa ttttggaaaa gattaaaagc atgaatggga atcgagagct gatttttgta       660
     ggcgatcacg atccgcgtaa acccatgagt gagaatacgg tgaacaaggc tctgcgagtg       720
     atgggttatg acacgaaaac ggaagtatgt gggcatgatt ttatcacact acagagtgcc       780
     ggtaataccg atttagataa cctagagcga aatattcagg gaaaaatcca acatacggat       840
     aatccaagag aactggttgc aacagaattg gctcttaact tgctaactga acaaattgca       900
     tcatccgatg tcctcagtgg atcacacctt tggtggttca agagaaatga gccactgtgc       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page