(data stored in ACNUC1104 zone)

EMBL: FN667741.PE449

FN667741.PE449       Location/Qualifiers
FT   CDS_pept        complement(459232..461028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0090"
FT                   /locus_tag="XBJ1_0455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79604"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79604.1"
FT                   /translation="MLNPNNRSLYTSALTSPPGMVFDEAIATSFSLDPAFLLQAPVYLA
FT                   FTATDSNRAQDPLSIFEAIRRYSERITVYVQKGRIQVPTKLKPNPLFGLLEDMIVESKA
FT                   KGRGVFHPKIWAIRFINPETDEVMYRLVVLSRNLTTDSSWDLSLQLDGYPVKRKQSANK
FT                   ALVHLFSVLPKRATGKMAKHRRKQAQRFADELLYIEWECPAGFDKVAFFLPGEGYEWKP
FT                   PEADRAVVISPFCTDEALRHIVEHCQQADALISRPDTLLALSKKTLNLFTRQLHLDDAA
FT                   EGQMHDESSPDEIIASGLHAKAYLFENGRDSELVLGSANATSAALLGKTNCEILVSLKG
FT                   KKKHTGTIDDLLSSDGMGSYLQDFDPAQPFEPDALRVKAECHLEQARTLLAEATLSLHG
FT                   HPGQNDQSWALWLIGEIPKLPGVVQATAWPITVSEVLSCNLQDPNKENKRELGEFSVQA
FT                   ITGLTAFSLKTSHPDVSLRFVLNLPIDSLPPDHNAMILQSSMRNQDFLRYLLMLIGETG
FT                   HQSFFAENTFGDGHFFTGLANGEEFSVLEELTRIYSREPERLNDIAALVENMRKGKNDM
FT                   IPQDFLALWAVFESAMGGRYGR"
     atgctaaatc ccaacaatcg cagcttatat acttcggcac tgacttctcc tcccggtatg        60
     gtgtttgacg aagccatagc tacaagcttc tcactcgacc cggcattttt actgcaggca       120
     ccggtctatt tggctttcac agcaaccgac agcaatcgcg ctcaggatcc gctatccatt       180
     tttgaagcca ttcgtcgtta ttccgaacgt atcacggtat acgttcaaaa aggccgcatt       240
     caagttccca caaagctcaa gcccaaccct ttgttcgggt tgcttgaaga tatgattgtt       300
     gaatcaaaag ccaaaggccg cggggtcttt caccccaaaa tctgggcgat tcgttttatc       360
     aatcctgaaa cagacgaagt catgtatcgg ttggtagtac tgagccgaaa tttaaccact       420
     gattcgtcct gggacctctc tttgcagttg gacggctacc ctgtaaaacg taagcaaagt       480
     gccaataaag cactggtgca tttattctcc gtattgccca aacgggcgac gggaaaaatg       540
     gcgaaacatc gccggaagca ggcgcagcgc ttcgcagatg aactgttgta tattgaatgg       600
     gaatgtcccg ctggttttga taaagtcgcg tttttcctgc ccggagaagg ttacgaatgg       660
     aagccacccg aagcggatcg tgcggtggtt atatcaccgt tttgcaccga tgaggccctg       720
     cgccacatcg tggaacattg ccaacaagct gatgccctga tttcaagacc tgacaccctg       780
     ctcgccttga gtaaaaagac gctcaacctt ttcacgcgcc agcttcatct tgacgacgca       840
     gccgaagggc agatgcacga cgagagctca cctgatgaga tcattgcctc cggtctgcat       900
     gccaaagcgt atctatttga aaatggccga gacagcgaac tggttctggg ctcagcgaac       960
     gccaccagcg cggcgctact ggggaaaaca aactgcgaaa ttttagtctc gctcaagggt      1020
     aagaaaaagc acacgggcac tattgatgac ctccttagca gcgacgggat gggaagctat      1080
     ctgcaagatt tcgaccctgc ccagccgttt gagcccgatg ccctgcgtgt caaagcagaa      1140
     tgccatcttg aacaggcgcg tacgttgctt gctgaagcta cattgagtct tcatggtcac      1200
     cccggtcaaa acgaccaaag ctgggcattg tggcttattg gcgagattcc taagttaccg      1260
     ggagttgtgc aggcaacagc atggcccata acggtatcag aagtgttaag ctgcaatcta      1320
     caggacccga ataaggagaa taaaagagaa ctcggagagt tttcagtcca agcaattacc      1380
     ggactgacag cgttttccct taaaacatcg cacccagacg tatcgctcag gttcgttctc      1440
     aatctgccaa ttgattcctt accccccgat cacaacgcaa tgattttaca aagcagcatg      1500
     cggaatcagg attttctacg ttacttgttg atgttgatag gtgaaacggg gcatcaatcc      1560
     ttctttgccg aaaatacctt cggtgatggt catttcttta cagggctagc caatggagag      1620
     gaattcagcg ttctggaaga gctgacacgt atctatagcc gcgaacccga acgtttaaac      1680
     gatatcgccg cgctggtgga aaatatgcga aaagggaaga acgacatgat tccgcaagat      1740
     tttcttgctc tgtgggccgt atttgaatca gccatgggag gacgatatgg ccgataa         1797
//

If you have problems or comments...

PBIL Back to PBIL home page