(data stored in ACNUC1104 zone)

EMBL: FN667741.PE45

FN667741.PE45        Location/Qualifiers
FT   CDS_pept        complement(56641..56952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0010"
FT                   /locus_tag="XBJ1_0049"
FT                   /product="Inner membrane protein yjcH"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79200"
FT                   /db_xref="GOA:D3UY22"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79200.1"
FT                   /translation="MNPDIYQEIENNPRFKELVQKRGRFAWLLSAIMLVLYVGFIFLIA
FT                   FSPEWLGTPLYEGSSMTRGIPVGVGIIFISFILTGIYVVRANGEFDRLTSTILNEVKK"
     atgaatcctg atatttatca agagattgaa aataatcccc gctttaagga attggttcag        60
     aagcgtgggc gctttgcctg gttgttatcc gccatcatgt tagtacttta tgttggattt       120
     atttttctta tcgctttttc ccctgagtgg cttggtactc ccctctatga aggctccagc       180
     atgacgcgtg gtattcctgt gggggttggc attatattta tttctttcat attgacaggg       240
     atctatgttg tcagagcgaa tggtgaattt gatcgtttga cttcgactat cctcaatgag       300
     gtaaaaaaat ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page