(data stored in ACNUC1104 zone)

EMBL: FN667741.PE457

FN667741.PE457       Location/Qualifiers
FT   CDS_pept        complement(465272..465592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79612"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79612.1"
FT                   /translation="MKNTTTPTLEGHTITEYLGVVTGETILGVNIIKDFFAGVRDIIGG
FT                   RSGAYEKELKNAREIAFAEMNAQAQALGANAVVGIDIDYETVGKNGGMLMVTVSGTAVK
FT                   IV"
     atgaaaaata caacaacacc tacgctggaa ggtcatacca tcacggaata tctgggtgtc        60
     gtcacagggg aaacgattct tggggtcaat attattaagg atttttttgc tggggtgaga       120
     gatatcatcg gcggacgttc tggcgcttat gagaaagaat tgaaaaatgc acgggaaatc       180
     gccttcgcgg aaatgaatgc acaagcccaa gcgctaggag ccaatgcggt tgtcggtatt       240
     gatattgact atgagacggt tggtaaaaat ggcggcatgt tgatggtcac tgtctcgggg       300
     actgcggtga agattgtgta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page