(data stored in ACNUC1104 zone)

EMBL: FN667741.PE458

FN667741.PE458       Location/Qualifiers
FT   CDS_pept        466061..466183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79613"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79613.1"
FT                   /translation="MKSILAEKSEARNGFYYQFKKRRFYFFRCFNDFFMTKRLF"
     ttgaaatcta ttttggctga aaagtcagaa gcgagaaatg gtttctacta ccagtttaag        60
     aaacgtcgct tttacttttt ccgctgtttc aatgacttct tcatgactaa gaggctgttc       120
     tag                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page