(data stored in ACNUC1104 zone)

EMBL: FN667741.PE460

FN667741.PE460       Location/Qualifiers
FT   CDS_pept        466412..466582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79615"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79615.1"
FT                   /translation="MKVQLACDALIMCFGYINAKVCDCVRWQRKSILVGGLLGIIDKRY
FT                   DLHCSMSAKAC"
     atgaaggtac aactggcctg tgatgcacta attatgtgct ttggctacat aaacgccaaa        60
     gtatgtgatt gtgtacgctg gcagaggaaa tcaatactgg tcggaggatt attaggcatt       120
     attgataaaa ggtatgactt gcattgcagt atgagtgcta aagcctgctg a                171
//

If you have problems or comments...

PBIL Back to PBIL home page