(data stored in ACNUC1104 zone)

EMBL: FN667741.PE461

FN667741.PE461       Location/Qualifiers
FT   CDS_pept        467190..468611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79616"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79616.1"
FT                   /translation="MNLTDKTQFLLGINKSTSILHPYIRTIITFILSGTKQQINSYFNC
FT                   FLGRSPKYGEIPPFPAVDTLSIDILLNFYEATHRFLVNTSSGLAILEKMTKLIYAVAKE
FT                   KSSQSVLFFMSYFNTDINPRYAIDIANTFFDADNISLENSVYTQSLAYNTALTATKIGD
FT                   ISEAEHWLDYIDDDDKKNRIISIVTEIDKKQNARKKHPLNPKNIKIKNINEIETLDLIS
FT                   ICSFLDGCGDDWGFKELYRSGSYIFPSKILTTEMFKSLAVKGIITLTQQDFDNIENKLL
FT                   NDFDHIVNNFKFHLNVIGIIDNRKISIKIFLEEIDRRKDKFDASFEMWKEISTGYFHDA
FT                   MEYYLGNIRDSWSNEFMLNEKTIERLSTTCLSAKDLSYIASSSVRYSAGQHAIKYTQSN
FT                   RHTCNTLISSINKNIDWVESDKFLGKAYPRGKKQPVLSSERIIEHITNINPDDLYNNVP
FT                   KLTEPVIKDETESDK"
     atgaatctta cagataaaac acaattcctt ctcgggataa ataaatcaac atctatttta        60
     catccatata ttagaactat tattactttt atcctctcag gcactaagca gcagataaat       120
     tcttacttta attgttttct gggacgttct ccaaaatatg gtgagatacc gccattccct       180
     gccgttgata ctttatctat tgatatcttg cttaatttct atgaagcaac acatagattc       240
     ttagtcaaca cctcttcagg gctagctatt cttgaaaaga tgacgaaact tatctatgca       300
     gttgcaaaag aaaaatctag tcaaagtgtg cttttcttta tgtcatattt taatacagat       360
     ataaaccccc gttatgctat agatatagca aatactttct ttgatgcgga taacatttca       420
     ttagaaaata gtgtgtatac tcaatctttg gcatataaca cagctttaac tgcaacaaaa       480
     attggagata tcagtgaagc agaacactgg ctggattata tcgatgatga tgataaaaag       540
     aatagaatta tatcgatcgt cacagaaata gataaaaaac aaaatgcaag aaaaaaacac       600
     ccattaaatc cgaagaatat taaaataaaa aacattaacg aaattgaaac gcttgatctt       660
     atatcaattt gttcatttct tgatggttgt ggtgatgatt ggggttttaa agaactctat       720
     cgatcaggta gttacatttt tccatcaaaa atattgacaa ctgagatgtt taagtcgcta       780
     gctgtcaaag gaataataac tctaactcaa caggattttg ataacattga aaacaaatta       840
     ctcaatgatt ttgaccatat tgttaataat tttaagttcc atttaaatgt tatagggatt       900
     attgataata gaaagatctc cattaagata ttcctagagg agatagatag aagaaaagat       960
     aaatttgatg cgtcctttga aatgtggaag gaaatttcta ctggatattt tcatgacgca      1020
     atggagtatt atttaggaaa tataagagat agttggtcaa atgagttcat gctcaatgaa      1080
     aaaactattg aaagactctc gactacgtgt ttgagtgcaa aagatctctc ttatatagca      1140
     agttcatctg ttaggtattc cgcaggacaa catgccatta aatatacaca aagcaataga      1200
     cacacctgca atactttaat tagcagtatt aataaaaata ttgactgggt tgaaagcgat      1260
     aaatttctag gaaaagcgta ccctagaggc aaaaaacagc cagttctatc ctctgaaagg      1320
     attatcgagc atattactaa tattaatcca gatgatttat acaacaatgt accaaaattg      1380
     acagaaccag tcatcaaaga tgaaactgaa agtgataaat aa                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page