(data stored in ACNUC1104 zone)

EMBL: FN667741.PE462

FN667741.PE462       Location/Qualifiers
FT   CDS_pept        complement(468698..468970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0468"
FT                   /product="chromosome replication (initiation and chain
FT                   elongation) with nucleoside triP hydrolase domain
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79617"
FT                   /db_xref="GOA:D3UWA8"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79617.1"
FT                   /translation="MLQELSTVDLLVIDEIGMQIESRYEKVTINQIVDRRSSSKRPTGM
FT                   LSNLDMNGMNTLLGERVMDRMRLGDSLWVIFNWGSYRSRIKGNEY"
     ttgctgcaag agctgagtac tgttgattta cttgtaattg atgagatagg catgcagata        60
     gagtcacgct atgaaaaagt gactatcaat cagatagtag atcgtcgttc atcatcaaag       120
     cgtcccactg gtatgttgtc aaatcttgac atgaatggta tgaatactct acttggtgaa       180
     agggtaatgg atcgtatgcg tcttggtgat agcctatggg ttatatttaa ttggggcagt       240
     tatcgtagtc gtattaaagg aaatgaatac tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page