(data stored in ACNUC1104 zone)

EMBL: FN667741.PE471

FN667741.PE471       Location/Qualifiers
FT   CDS_pept        complement(474920..476344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0477"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79626"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79626.1"
FT                   /translation="MKRFFLVFVLTLFLSGCGDADEGYYLIKNIDVIFDEDEGLEDFKE
FT                   LIAKKIKGEKDYMYFFLTPDEASYFTGVKPEKTAIKDNRLEIGHDMLTLKNTFSGVKLV
FT                   GDKKRICGFYNCIITFELDKVKQNDKRLLDIQNKFKESEIKKQKLYAAQKEKLAELVFK
FT                   DFFGQLTYLDDFSIKLEPIESGSLNEINSGIYFRNMGGLRIDLESEDNTIYNFKNQNSQ
FT                   LIGELFIIKSLKDKFDYSSWLEIQDEILYQDKQGAIYYNMHGELEAVYYQYDEKSQHYF
FT                   IGLANAPKLETIKKSYIMLRTMDEQYRGEIANIQDVSLSQTDFENKYGIKISDSFDSQE
FT                   IHKVLIKKMNDKLAETKDFSKDKDWFNSILVRFPSESFSSKIYFYFHPKPMKKVISEFK
FT                   NKYPRGKWIENVFVYNISPSSESGYSYFINHNGMVYEIFVATDIHSTVERMAFLSVLRH
FT                   LDPTKLQGYSPSKLRP"
     atgaaaaggt tttttttagt gtttgtactt acgttatttt tgtcaggttg tggtgatgct        60
     gacgaaggtt attatcttat caaaaatatt gacgtcattt ttgatgaaga cgaagggctt       120
     gaggatttca aggaattaat tgcaaagaaa atcaaaggag aaaaagatta tatgtatttt       180
     tttctgactc ctgatgaggc cagctacttt accggtgtta aaccagaaaa aacagcgatc       240
     aaggataaca ggcttgagat tggccatgac atgcttactc tgaaaaacac gttttcaggt       300
     gtcaaactag ttggtgataa aaagagaatc tgtggttttt acaattgtat aattaccttt       360
     gaattagata aagttaaaca aaatgataaa agacttcttg atatacaaaa taaattcaaa       420
     gagtcagaaa ttaaaaaaca aaaattatat gctgcacaga aagaaaaact ggctgaactt       480
     gtttttaagg atttctttgg tcagttaacc tatttagacg attttagtat taaactcgag       540
     ccgatagaat caggctcttt aaatgaaatt aattctggta tatattttcg taacatgggt       600
     ggattacgta ttgatttgga gagtgaagat aatacaattt ataatttcaa aaatcaaaac       660
     agtcaactta ttggtgaatt atttattatt aaatccctca aagataaatt cgattattca       720
     tcatggttag agatacaaga tgaaatatta tatcaagata aacagggcgc tatttactac       780
     aatatgcacg gtgaactgga agcagtttat tatcaatacg atgaaaaatc ccaacattat       840
     tttatcggtc ttgctaacgc acctaaatta gaaaccataa aaaaatccta tattatgcta       900
     cgtactatgg atgagcagta ccgaggagaa atcgccaata tacaggatgt ttctctatct       960
     caaactgact ttgaaaacaa atacggaata aaaatatccg atagttttga cagtcaagaa      1020
     atccataagg ttcttatcaa aaaaatgaat gataagttgg ctgaaactaa agatttttcc      1080
     aaagataaag attggttcaa ttccatattg gtaaggtttc catcagaatc atttagctcc      1140
     aaaatttatt tttattttca tccaaaacct atgaaaaaag ttatttctga atttaagaat      1200
     aaatacccta gaggaaaatg gattgagaat gtttttgttt acaatatttc tccatcttcc      1260
     gaaagcggct atagttattt tattaaccat aatggtatgg tttatgagat atttgtggcc      1320
     actgatattc atagcaccgt cgaacgaatg gctttcctca gcgtattacg tcatttagat      1380
     cctactaagc tgcaagggta ctcaccttca aagctgcgac cttaa                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page