(data stored in ACNUC1104 zone)

EMBL: FN667741.PE483

FN667741.PE483       Location/Qualifiers
FT   CDS_pept        complement(488946..490673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0094"
FT                   /locus_tag="XBJ1_0489"
FT                   /product="Alkaline protease secretion ATP-binding protein
FT                   aprD"
FT                   /EC_number="3.6.3.43"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79638"
FT                   /db_xref="GOA:D3UWC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79638.1"
FT                   /translation="MKLRFPKDEITDVIRARSKVFWTIGLFTAFINLLMLVPSIYMLQV
FT                   YDRVLPSSNEMTLLMLTLITLGMFAIMGGLEYIRSMVVIRIGSQFDMCLNQRVYTASYE
FT                   SNLKNGSTDAGQMLNDLATIRQFLTGNALFAFFDVPWFPIYLWVIFLFSPYLGLLALVG
FT                   AIILITLAVLNQWLSQSPLSEASHLSLRSANLASTNLRNAEVIEALGMLPALRQRWFSL
FT                   HERFLNFQRIASERAASITALTKTVRMALQSLILGLGGWLAIEGNITPGMMITGSILMG
FT                   RALSPIEQLIQAWKSWSAARLSWQRLDKLLKAQPERKSGMSLPAPKGILLLEKVAAIPP
FT                   SKTQARQTAGNHKQVLQDISFSLNAGDVLGVIGPSASGKSTLARLLVGIWPSQEGVVRL
FT                   DDADIYQWNKDELGASIGYLPQDIELFGGTIAENIARFNDVDPEKVIEAAKKAGVHELV
FT                   LNLEQGYDTVIGTGGMGLSGGQKQRIGLARALYGNPSLLVLDEPNSNLDDIGEKALSQA
FT                   ITQLREQGKTVVVITHRPSLLSQTNKILLLVQGKMKMFGPSQQVMAALSQSKTVERAS"
     gtgaaactac gctttccaaa ggatgaaatc acggatgtta tccgtgcacg cagcaaagta        60
     ttctggacta ttggcttatt tacggcattt atcaatctgc tgatgttggt tccctctatt       120
     tatatgcttc aggtatatga tcgagtcctg ccatccagta atgaaatgac tctgctgatg       180
     ctgaccctga tcacgctcgg catgttcgct attatgggcg ggctggaata tatccgtagc       240
     atggtggtga tccgcatcgg cagccagttt gatatgtgcc tgaaccagcg tgtttatacc       300
     gcgtcgtatg agtccaacct gaaaaatggc tccaccgatg ccgggcaaat gctcaatgac       360
     ttggcaacta tccgccagtt cctgacgggc aatgcgctgt ttgctttttt tgatgtgcct       420
     tggttcccga tctatctctg ggttattttt ctgtttagcc cgtacttggg actgctggcg       480
     ctggttgggg cgatcatttt gatcacgttg gcggtactga accaatggct gtctcagtcg       540
     cctttatcgg aagcgagtca tctctccctg cgctctgcca atcttgccag tactaatctg       600
     cgtaatgcgg aagtcattga agccttgggt atgttgccgg cactgcgtca gcgatggttt       660
     agcctgcatg agcgctttct caatttccag cgtattgcca gcgaacgggc agcatccatc       720
     accgcactga ccaaaacagt gcgcatggcc ttgcagtcgt tgatcctcgg tttgggaggc       780
     tggctggcga ttgaaggcaa tatcacgccg ggtatgatga tcacgggttc tatcttgatg       840
     ggacgggcat tgtcgccgat tgagcagttg atccaagcgt ggaaaagctg gagcgccgct       900
     cgtctgtcat ggcagcgact ggataaattg ctgaaggcgc agccagaacg taaaagcggt       960
     atgtcactgc ctgcccctaa aggtattttg ttgctggaaa aagttgccgc aataccaccg      1020
     agtaaaacac aggccagaca aacggcgggg aatcataaac aggttttgca ggatatcagt      1080
     ttttccctga atgccggcga tgtgttgggc gtgattggcc ccagtgcgtc ggggaaatct      1140
     acgctggctc gcctgctggt ggggatttgg ccgtcacagg aaggtgttgt gcggctcgat      1200
     gatgccgata tttaccaatg gaacaaggat gaactggggg catcgatagg ttatttgccg      1260
     caggacatcg aactatttgg tggcacgatt gcggaaaaca ttgcgcgttt taatgacgtg      1320
     gatcctgaaa aagtcattga agcggccaaa aaagcgggtg tccatgaact ggtactcaat      1380
     cttgaacagg gttatgacac ggtgattggc actggaggaa tgggattgtc cggtgggcag      1440
     aagcagcgga ttgggctggc acgggcattg tacggcaatc cgtcgctgct ggtgctggat      1500
     gaaccaaatt ccaatctgga tgatatcggt gaaaaggcgc tgagtcaggc gattacgcaa      1560
     ttgcgggaac agggcaaaac agtggtagtg atcacgcatc ggccttcttt gctctcacaa      1620
     acaaacaaaa ttttgctgtt ggtgcaggga aaaatgaaaa tgtttggccc atctcagcaa      1680
     gttatggcgg cgctgtcgca gtcaaaaaca gtcgaacgtg cctcgtaa                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page