(data stored in ACNUC1104 zone)

EMBL: FN667741.PE498

FN667741.PE498       Location/Qualifiers
FT   CDS_pept        505963..506493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0098"
FT                   /locus_tag="XBJ1_0504"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79653"
FT                   /db_xref="GOA:D3UZ71"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79653.1"
FT                   /translation="MSLHEIIELVTDFVKAHEYWAIPIVFLLAFGESLAFISLLLPATI
FT                   ILLGLGALIGESGLNFWPIWIAAAAGAFFGDWVSYLFGAHYKDNVGKMWPLSRHPQMLV
FT                   RGHRFFERWGVWGVFIGRFFGPLRAVIPLVAGICAMPKRHFQLANFASALIWAFGILAP
FT                   GAFGLRWLAEWMG"
     ttgagtttgc atgaaattat cgaactggtc acagacttcg taaaagccca tgaatattgg        60
     gcaatcccca ttgtttttct acttgctttt ggtgaatctc tggcatttat ctccctgctg       120
     ttgcctgcga cgatcatttt attaggattg ggggcgttga ttggtgaaag cgggttaaat       180
     ttttggccaa tatggatagc ggcagcagcg ggagcctttt ttggcgattg ggtttcctat       240
     ctgtttggtg cccactacaa ggacaatgtc ggcaagatgt ggccactgtc acgtcatccg       300
     caaatgttag tgcgcggcca tcgatttttt gaacgctggg gagtttgggg tgttttcatc       360
     gggcgttttt ttggtccatt gagagctgtt ataccactgg tagcgggtat ttgcgccatg       420
     ccgaaacgtc atttccagct tgccaatttt gcctctgcgc tgatttgggc cttcggtatt       480
     ttggctccgg gagcgtttgg tttacgctgg ctggcagaat ggatgggcta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page