(data stored in ACNUC1104 zone)

EMBL: FN667741.PE512

FN667741.PE512       Location/Qualifiers
FT   CDS_pept        complement(520513..520653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79667"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79667.1"
FT                   /translation="MIIWQEYKSYHNSLFLVSPWGNLTLVRLTDNIYIFHNYNKKYCHP
FT                   S"
     ttgattatct ggcaggagta taaatcttac cacaattcat tatttttagt gtcaccatgg        60
     ggaaatctca ccttagtgcg gttgactgac aatatttata tttttcataa ctataataaa       120
     aaatattgtc atccatcata a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page