(data stored in ACNUC1104 zone)

EMBL: FN667741.PE520

FN667741.PE520       Location/Qualifiers
FT   CDS_pept        533367..534965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0105"
FT                   /locus_tag="XBJ1_0531"
FT                   /product="putative allophanate hydrolase subunit 1 and 2"
FT                   /EC_number="3.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79675"
FT                   /db_xref="GOA:D3UZ93"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79675.1"
FT                   /translation="MRFLLVNFNTILVELSGLPETLALFDSLSIVPVLGIEEIIPAART
FT                   LMIRFRPTKISIHQLVAEIGHRDLHECSHPQGKQIEIPVHYNGDDLAEVAEILGCTAQD
FT                   VIRQHTENEYTVAFSGFAPGFAYMVSDMAQWNIPRRQTPRTRIPAGAVALAGEFSGIYP
FT                   QASPGGWQIIGITTERMWDLSRPDPALLQPGYRVNFRDAGRATVTVSLSETSRTNPVFQ
FT                   SETSRYLEIRSVGLQTLFQDLGRFGKSGLGISESGAMDKSALRSANRIVGNSSEQACLE
FT                   IVQGGFKAVACGQMMVAVTGALCPIEIKTPQGELIHVSAYKPIDLSDGDEIILGRPDAG
FT                   TRSYLAVRGGFTIPSVLSSRSFDTLSHIGPEPLKAEDKLVVGTTSHCAAVSFSETLAFV
FT                   MPNKNEIVVLDVLLGPRTDWFTQESIDLLRNQIWQVTPQSNRIGLRLNGECSLSRIKCQ
FT                   ELPSEGTCAGAIQIPASGQPVLFLSDHPLTGGYPVIASVAHYHLDLAGQIPVNAKIRFN
FT                   PIIQFHELSGSEDLR"
     ttgcgttttt tacttgttaa tttcaataca atacttgttg aactcagtgg attgccagaa        60
     acattggcgt tgtttgattc actgagtatt gttccggtat tggggattga agagattata       120
     cctgcggcga gaaccctaat gattcgtttt cgtccaacga aaatctcaat tcaccaactc       180
     gtagcagaaa ttggccaccg tgacttgcat gagtgcagtc atcctcaagg aaaacagatt       240
     gaaattccgg tgcactataa tggtgacgat ttagcggaag ttgctgaaat actggggtgc       300
     acggctcaag acgttatccg ccagcatacc gaaaacgaat atacagtggc ttttagcgga       360
     tttgcgcctg gttttgctta tatggtatcg gatatggcac agtggaatat tccccgtcgg       420
     caaacaccaa gaacccgtat tcctgcgggt gccgttgcac tggcgggaga attcagtggt       480
     atttaccctc aggcgagtcc cggtggttgg cagattatcg gcatcacaac cgaacgtatg       540
     tgggatcttt cccgtcctga tcctgctcta ttacagccgg gttatcgtgt caattttcgg       600
     gatgctggac gtgccactgt aacggtaagt ttgtcagaga cctcacgcac caatccggtt       660
     tttcaatctg aaacttctcg ctatttagaa atccggagtg tgggattgca aaccctgttt       720
     caagatttag gacgttttgg caaatcggga ttggggatct cagaatccgg tgctatggat       780
     aaaagtgctt tgcgaagtgc aaaccgtatt gtaggtaatt cttccgagca ggcgtgtctg       840
     gagatagtac agggtggttt taaagcggtt gcctgtgggc agatgatggt tgctgttaca       900
     ggtgcgctat gtcctattga gataaaaact ccgcagggtg aactcattca tgtaagtgct       960
     tacaaaccca ttgacttaag tgatggtgat gaaattatct tgggaagacc tgatgcggga      1020
     acgcgttctt atttggccgt gcggggtggt tttacgatcc cttctgtatt atccagtcgc      1080
     tcatttgata cgctatctca tatcgggcct gagccactaa aagccgaaga taaattggtc      1140
     gtgggaacaa cgtctcattg cgctgcggtg tctttttctg agacgcttgc ttttgtgatg      1200
     ccaaataaaa atgagattgt ggtattggat gtgctccttg gccctcgcac tgactggttt      1260
     actcaagagt cgattgattt attacgaaac cagatttggc aggtgacgcc acaatccaac      1320
     cggattggct taagattaaa tggtgagtgt tcactatcac gcattaagtg ccaagaactg      1380
     cctagcgaag gaacctgtgc cggagccatt caaattcctg ccagtggtca gcctgtgctg      1440
     tttctgtctg atcatccatt gacaggagga tatcccgtca ttgcttctgt ggcacattat      1500
     catcttgatc ttgcaggtca gatcccggtc aacgccaaaa ttcgatttaa tcccatcata      1560
     caatttcacg aattatcagg gagtgaagac ttgcgatga                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page