(data stored in ACNUC1104 zone)

EMBL: FN667741.PE532

FN667741.PE532       Location/Qualifiers
FT   CDS_pept        546239..549475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0543"
FT                   /product="Putative non-ribosomal peptide synthetase
FT                   (fragment)"
FT                   /EC_number="5.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79687"
FT                   /db_xref="GOA:D3UZA5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79687.1"
FT                   /translation="MNTHTHKAILHTAFTEQTFSPDDNINSSNISHRIAALEPWFDNVP
FT                   SRLAKLAKTIPNDIAVSDPYETLVFGELQQRVENAANILHQYGVKMGSNVAIAAERGIP
FT                   WFVTMLAVWRIGAVYIPLNTMMPEKRLNDILASLSESVLVSDDTVSAGLKASTLIPLHA
FT                   LLNNTREIINDEITENIDMPALGDHPAYVMFTSGSTGLPKAVQVQHDNLAACLCAFGKL
FT                   LSVNQHDCMLTLTTFSFDISLMELLLTVVHGGSIYITSIDTQRDAMALSQILSDPQFTF
FT                   AQATPVTWLMALNAGWKPRSELSMLCGGEALSQDLADQLTASGGTLWNLYGPTETTIWS
FT                   TAFRMRKGDKVQLGGPIPGTTITIVDKYLRPVPKGTVGEILIGGLGVTAGYRNNPTETA
FT                   KRYVPDMTQRGKRAYLTGDMARMLEDGSLIYMGRQDDQVKVRGYRIELGEIETALRKQN
FT                   GVQDAIIRVIGSGDLAKIQAFVLFDPNRVVSEDWVHETQISLREVLHEAWIPAEYYRIP
FT                   YIPLTSSGKRDRKRLDEVAERLNASYDVVLPQTETEKQVYAIWRDLLATDVLGVTDNFF
FT                   QVGGHSILVARMVERIEKAFSLRIPISGIYVEPTVARISSILDEMIEAYQANPANAGGV
FT                   YHSEALIQQHAETLRKDVYLKESVCPDGLPHANWYQPDTVLLTGATGYLGLHLLEQLLK
FT                   QTAARIICLCRDSDEEHARDRIKAGFDKYQIDVVNGLERVDVIIGDLGQPRFGLLPETW
FT                   AQLAENVDVIYHNGALVNFIYPYSALKSINVDGTRTALEFACTARLKHFHYVSSVNALF
FT                   ATESPRPFMEDDRTMSESVRDPSGYSGSKWVSEGIINIARKRGVPVSIYRPGLILGHTL
FT                   TGAAQGNDYLVASLKGYLAMGFYPEHGLLLDIVPVDYVAASLVHISSQPESDGKFFNLF
FT                   NPVQVSIRQFFDWVQEFGYVLNPIPFNEGKEKILALDDTHPLYPLIPLIRDMTEKPYRA
FT                   LDPAYVHEIHPELELKQTLALLANTDIKCPVITAGYVHQVLQYLIDTGFLPAALPENFK
FT                   PEAYLGTANRKRSHELDSRREQQKKVFGLA"
     atgaatacac acacacacaa ggcaatatta cacacagcat tcactgagca aacattttca        60
     cccgatgaca atattaacag tagtaatatc agtcatagga tagcagcact tgaaccatgg       120
     tttgataacg tgccatctcg cttggcaaaa ctggcgaaaa cgataccgaa tgacattgcg       180
     gtttctgatc cctatgaaac cctggtattt ggtgaattac agcagcgtgt tgaaaatgca       240
     gcaaatattt tgcatcagta cggtgttaaa atggggagca acgttgctat tgctgccgaa       300
     cggggaattc catggtttgt tactatgctg gcggtttggc gaattggggc ggtttatatt       360
     ccccttaata cgatgatgcc agaaaaacgt ctgaatgata ttctcgccag cctgtcggaa       420
     agtgttctcg tatcggatga tacggtatct gcggggctga aggcatcaac attaatccct       480
     ttgcacgccc ttctgaataa tacccgtgaa ataattaatg atgaaataac agaaaacatc       540
     gatatgcctg cattgggtga tcacccggct tatgtgatgt tcacttctgg ctctactggg       600
     ttgccaaaag cggtacaggt gcagcatgac aatctggctg cctgtctgtg tgcattcggc       660
     aagttactgt cagtcaatca gcatgattgt atgctcaccc tgacgacctt ttcttttgat       720
     atctcattaa tggaattact actgactgtc gttcatggcg gcagtatcta cattacatca       780
     atcgatactc agcgtgatgc gatggcgttg tcgcaaatac tgtctgatcc ccaattcacc       840
     tttgcacaag cgacacctgt tacttggtta atggccttga atgctggctg gaaacctcgt       900
     tcagagttga gcatgctttg tgggggagag gcgttgtcac aggatttggc cgatcaatta       960
     acggcatccg gtggcacttt atggaatctc tatggcccaa ccgaaaccac tatctggtca      1020
     acagcatttc gcatgagaaa aggagataag gttcaattgg gtgggccgat ccccggcaca      1080
     accatcacaa ttgtagacaa atacttgcga ccggtgccga aaggaacggt gggtgaaatc      1140
     cttattggtg ggcttggggt gacggctgga tatcgcaata acccgaccga aacggctaaa      1200
     cgatatgtac ccgatatgac acaaagaggt aaaagagcgt atttgaccgg agatatggca      1260
     cgtatgcttg aagatggctc tctcatttat atgggaaggc aggatgatca ggtaaaagtg      1320
     cgtggatatc gaatcgagtt gggtgagatt gaaaccgcat taagaaaaca aaatggcgta      1380
     caggatgcga ttattcgtgt tatcggcagt ggcgatcttg ccaaaattca ggcgtttgta      1440
     ctgttcgatc ccaatagggt tgtatccgaa gattgggtac atgaaaccca gatttcactc      1500
     agggaagttc tgcacgaagc ctggatacct gccgaatatt atcgtatccc ttacatccca      1560
     ctgacgagca gtggcaaacg tgatagaaaa cggttagacg aagtcgcaga acggttgaat      1620
     gccagctatg acgttgtact gcctcaaaca gaaactgaaa aacaggttta tgcaatttgg      1680
     cgtgacctgc tggcgacaga cgtattaggt gtcaccgata atttctttca ggttgggggg      1740
     cattctattt tggttgcccg catggtggaa cggattgaaa aagccttttc actccggata      1800
     ccgatttcag gtatctatgt tgaacctacg gttgccagaa tctcgtctat tctggatgaa      1860
     atgatagaag cgtatcaggc aaatccggct aatgccgggg gagtctacca cagtgaggcg      1920
     ttaattcagc aacatgcaga aacgctcaga aaagatgtct acctgaaaga aagcgtgtgc      1980
     cctgatggcc tgcctcatgc gaactggtat cagccggata cggtattgct caccggcgct      2040
     acgggatatc ttggtctgca tttgctggaa caattgctga aacagactgc ggccagaatt      2100
     atctgtttgt gccgtgactc tgatgaagaa cacgcccgag acagaatcaa ggccgggttt      2160
     gacaagtacc agattgatgt tgttaacgga cttgagcgcg tagatgtcat tatcggagat      2220
     ttggggcagc cacgctttgg cttgttaccg gaaacatggg cacagctcgc tgaaaacgtt      2280
     gatgtgattt atcacaacgg ggcgttggtt aactttatct atccttatag cgcactgaaa      2340
     agcattaatg tcgatggaac ccgaaccgcg ctggaatttg cctgcacagc acgactgaaa      2400
     catttccatt atgtctcttc cgtgaatgcc ctgtttgcca cagaatcacc ccgtccattt      2460
     atggaagatg atcgtactat gagcgaatcg gtacgggatc cttctggtta ctcaggcagt      2520
     aagtgggtat ctgaagggat cattaatatt gcccgtaagc gaggtgtacc tgtcagtatt      2580
     tatcgtccgg gtctgatcct tgggcatact ctcacaggag ccgcacaagg caatgattat      2640
     ctcgttgctt ccctgaaagg ttatctggca atgggctttt accctgaaca tggattgctg      2700
     cttgatattg taccggttga ttatgtcgct gcatcgttgg ttcatatctc cagtcaaccg      2760
     gaatccgatg gtaaattctt taatttgttt aatccggttc aagtctcgat ccggcaattt      2820
     ttcgattggg tacaggagtt tggctatgtg ctcaacccaa tccccttcaa tgagggtaaa      2880
     gagaagatcc ttgcactgga tgatactcac ccattgtacc cattgatccc gttgattagg      2940
     gacatgacag agaaacctta tcgcgcgtta gatccggctt atgttcatga aattcaccca      3000
     gaactggagt tgaagcaaac gctggcatta ttggccaaca ctgacattaa atgccccgtc      3060
     attacggccg gatatgtcca tcaagtattg caatatttga tagatacagg tttcttaccc      3120
     gcagcactgc cagaaaactt caagccggag gcctatcttg gaacagctaa caggaaacga      3180
     agccatgaat tggatagtcg tcgtgaacag cagaaaaaag tattcggtct ggcctga         3237
//

If you have problems or comments...

PBIL Back to PBIL home page