(data stored in ACNUC1104 zone)

EMBL: FN667741.PE539

FN667741.PE539       Location/Qualifiers
FT   CDS_pept        complement(555009..555278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0108"
FT                   /locus_tag="XBJ1_0550"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79694"
FT                   /db_xref="GOA:D3UZB2"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79694.1"
FT                   /translation="MFIQLGKVIMVLVWGIMIFNLIHPFPKPLRYFMDIAMVFTVIMHA
FT                   FQLLLLKNSQPKDQKFSVFLQTKIFFFGVFELLTWQKKQRQDKK"
     atgtttattc aattaggaaa agttatcatg gttctcgttt ggggaattat gattttcaat        60
     ttgatccatc cctttcctaa accattgaga tattttatgg atatcgccat ggttttcaca       120
     gtgataatgc atgccttcca acttttacta ttaaaaaact cccaacccaa agatcaaaag       180
     ttttctgttt ttcttcagac caagatcttc ttttttggtg tgtttgagtt acttacttgg       240
     caaaaaaaac agcgtcaaga taaaaaataa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page