(data stored in ACNUC1104 zone)

EMBL: FN667741.PE541

FN667741.PE541       Location/Qualifiers
FT   CDS_pept        555982..556143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79696"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79696.1"
FT                   /translation="MINLPRNPHIDMCCDVMKMLDWILSPLEPIAAGVVVEKQSVCGDR
FT                   FLAYPNKY"
     ttgattaatt taccacgaaa tccacacata gatatgtgtt gtgatgtgat gaaaatgtta        60
     gactggattt tatcaccgtt agaacctatc gcagcaggcg tagtggttga aaaacaaagc       120
     gtctgcggcg ataggttttt agcttatcct aataagtatt aa                          162
//

If you have problems or comments...

PBIL Back to PBIL home page