(data stored in ACNUC1104 zone)

EMBL: FN667741.PE547

FN667741.PE547       Location/Qualifiers
FT   CDS_pept        complement(561644..562045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79702"
FT                   /db_xref="GOA:D3UZC0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032900"
FT                   /db_xref="InterPro:IPR040448"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79702.1"
FT                   /translation="MKLTIKPISVLSQQDKIDLKKIWPEQDTQEWEVLLAGDQKLFVAQ
FT                   FNGRLLAAVKVTLNSSTGILEDFCVREVTRRRGVGAYLLEQVKAAFPEINRWEWSLNHF
FT                   PDIHAPALRDFMDACDFRYDAQNNAYYYE"
     atgaagttaa caattaaacc aataagtgtt ttatcccagc aggataagat tgatttgaaa        60
     aaaatttggc cggaacaaga tacgcaggag tgggaagtgc tgttagcagg tgatcaaaaa       120
     ctgtttgtag cacaatttaa cggccgattg cttgccgcgg ttaaagtgac gctcaattca       180
     tcaacaggaa tactggaaga tttttgtgta cgggaagtga cccgtcggcg tggcgttggg       240
     gcttatctgc tggagcaggt caaggccgca ttcccggaga tcaaccgttg ggaatggagc       300
     ctgaatcatt ttcctgatat ccacgctcca gcgttgcggg attttatgga tgcctgcgat       360
     ttccgctatg atgcacaaaa taatgcctat tattacgaat aa                          402
//

If you have problems or comments...

PBIL Back to PBIL home page