(data stored in ACNUC1104 zone)

EMBL: FN667741.PE554

FN667741.PE554       Location/Qualifiers
FT   CDS_pept        572496..573464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0111"
FT                   /locus_tag="XBJ1_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79709"
FT                   /db_xref="GOA:D3UWD5"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79709.1"
FT                   /translation="MSILIKKIFKKIFRVKAPPTEPLFTFGDPVLEQKLILLDNKTVKR
FT                   AGFLDAINSKECHFRHNLIRARKEVIVPLMIGFMLGLGFFINDFVKGWKANEEDLLWSV
FT                   QNAKKRYGEQFYLNPNAPAYTKSLRVISDDKKISLTEYLYISYSKDSYYGEEMARRYLI
FT                   IDASFGLFFLSANILIISIFLRLRKPANFIIDHERQLFYTWKKGKVYVSRYKELGVAFA
FT                   NNILHFKCYGLNEKNELTYQFFIPYLSIFNSDEDKVYILAFMSKYLLQGKEAVSSVDFK
FT                   RQERLPWFRKQIKPADWETQITAILAELDRLEPPKGATEPK"
     atgagtatat taattaaaaa aatattcaag aaaattttta gagtgaaggc acctccaaca        60
     gagccattat ttacatttgg tgatcctgtt ctggagcaaa aactaattct gctggataat       120
     aaaaccgtaa aacgtgcagg atttttggat gcgataaata gcaaggagtg tcattttcgt       180
     cataatctta tcagagcaag aaaagaagtt atagtacctt tgatgattgg gtttatgtta       240
     ggtttgggat tttttattaa tgactttgtt aagggatgga aagctaatga agaggatctt       300
     ctttggtctg ttcagaatgc aaaaaaacgt tatggagagc aattttattt aaatccaaat       360
     gcacctgcat atactaagtc attacgagta atatcagatg ataaaaaaat atctctaacg       420
     gaatatttat atatttctta ttcaaaagat agctattatg gtgaagaaat ggctaggcga       480
     tatttgatta tagatgccag tttcggatta tttttcctga gtgccaatat tcttattatc       540
     agcatttttt taagattacg taagcctgca aatttcatca ttgatcatga aagacaactt       600
     ttttatacct ggaaaaaagg gaaagtgtat gtatctcgct ataaagaatt aggcgtagcg       660
     tttgctaata atattttgca tttcaaatgt tatgggctga acgaaaagaa tgaactgaca       720
     tatcagtttt ttattcctta tcttagtatt ttcaactcag acgaggataa agtttatatt       780
     ttggcattta tgtcaaaata tttattacaa ggaaaagagg ctgtcagttc agttgatttt       840
     aaacgtcaag agcgattacc gtggtttcgt aagcaaataa aaccagcgga ttgggaaact       900
     cagattacgg caatcttagc tgaattagat aggcttgagc caccgaaagg ggcgactgaa       960
     cctaaataa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page