(data stored in ACNUC1104 zone)

EMBL: FN667741.PE561

FN667741.PE561       Location/Qualifiers
FT   CDS_pept        complement(588227..589132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0113"
FT                   /locus_tag="XBJ1_0572"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79716"
FT                   /db_xref="GOA:D3UWE2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79716.1"
FT                   /translation="MPLIRLFREEDSTGVSALFRVVYGEDYVYPEVYLPTMLSRYNAAR
FT                   HWYSAVAIQNGQVLGHATLWRNGRCPSSAELSLIAVHPQARGQGIATALGRYLCDQAKE
FT                   MGLGMLTIKQVSSHNHSQRLAQNLGFHTTGLLPDYVISPFDQARPESIVLGCLPLQRWP
FT                   FPELHWPVNWQTWLTSVTQIFGQEPLKPAVPIDTGTRIASHGGRLEVWIETQTTERVKE
FT                   VTELPAHKLIYVKLPVGEETLHAVQILQQAGFACTGFVPGHHHRWEMLLVRGHSRKELT
FT                   LSCQFAHNLHQQSLFACAER"
     atgccgttga ttcgcttatt ccgggaagaa gattccaccg gagtcagcgc gttgtttcgg        60
     gtcgtttacg gcgaagatta cgtctatccg gaagtctacc tgccaaccat gctgagtcgt       120
     tataatgcgg ccagacactg gtattctgcc gttgcaatac agaatggaca agtgttagga       180
     cacgcgacat tgtggcggaa tgggcgttgc ccatcaagtg cagagctctc gcttatcgcg       240
     gtacatccac aagcgcgcgg acagggtatc gcaaccgcgc tgggtcgata tttgtgtgat       300
     caagccaaag aaatgggatt aggtatgctc acgattaaac aggtatcgtc gcataatcac       360
     agccagcgtc tggctcaaaa tttgggtttt cacaccacag gcttattacc ggattatgtg       420
     atatctccct ttgatcaagc acgtccggaa agtattgtac tcggttgcct gcctttgcaa       480
     cgctggccgt ttccagaatt acactggcca gtgaattggc aaacgtggct gacatcggtc       540
     actcaaatat ttggtcaaga accgctaaaa cccgcggttc caatagatac gggtactaga       600
     atcgccagtc atggagggcg actagaagtc tggatagaaa cacagacaac ggagcgggta       660
     aaagaagtga cagaactgcc ggcgcataag ctgatatatg tgaaactacc ggtcggagaa       720
     gagactctcc acgcggtaca aattttgcaa caagccggat ttgcctgcac agggtttgtg       780
     cctggtcacc atcatcgttg ggaaatgctt ctggttcggg ggcatagcag aaaagaactg       840
     actctaagtt gccagtttgc ccacaatcta catcagcaaa gtttgtttgc ctgtgccgaa       900
     aggtag                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page