(data stored in ACNUC1104 zone)

EMBL: FN667741.PE570

FN667741.PE570       Location/Qualifiers
FT   CDS_pept        complement(599238..599492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79725"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79725.1"
FT                   /translation="MIVIAIRLNWSLPAHSLTKYVPVSYSLQNHYIDSIGVPAYTSSSL
FT                   NPLPVGIFPGYFFTVVPNRTVKGSIIQRVETSHLNWLSK"
     ctgattgtca tagcaatccg gctaaattgg tcgctccctg ctcattccct gacaaaatac        60
     gtccctgtca gttattcctt acaaaatcat tatattgata gtattggcgt tcctgcctat       120
     acctcatcat ccttgaaccc acttcctgtt ggtatcttcc ctggttattt ttttactgtg       180
     gttcctaaca gaacagtgaa aggatctatt attcagagag ttgaaacaag ccacctgaat       240
     tggctcagta agtga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page