(data stored in ACNUC1104 zone)

EMBL: FN667741.PE571

FN667741.PE571       Location/Qualifiers
FT   CDS_pept        599647..599973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0115"
FT                   /locus_tag="XBJ1_0582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79726"
FT                   /db_xref="InterPro:IPR007384"
FT                   /db_xref="InterPro:IPR023376"
FT                   /db_xref="InterPro:IPR036814"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79726.1"
FT                   /translation="MNIEQQILLKLQLIEADMKAAGLWRSHPPKPEAFESTEPFSLDTM
FT                   SAEEWLQWVLIPRMRAMIEQNANLPTAFDITPYFEEVYKEEAERYLPLLEHLRELDSLF
FT                   TQDI"
     atgaatatcg aacaacaaat tctacttaaa ttacagctaa ttgaagctga catgaaagcg        60
     gctggcctgt ggcggagtca ccctcccaag ccggaagctt ttgaaagtac cgagcccttt       120
     tcgctagata cgatgtccgc agaagagtgg cttcagtggg ttttaattcc aagaatgcga       180
     gccatgatag aacaaaacgc caaccttccg acggcatttg atatcacacc ttatttcgaa       240
     gaagtctata aggaagaagc agaacgttat ctgccgctgc ttgaacatct tcgggaattg       300
     gacagcctgt ttacacagga tatttga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page