(data stored in ACNUC1104 zone)

EMBL: FN667741.PE574

FN667741.PE574       Location/Qualifiers
FT   CDS_pept        complement(601271..601657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0116"
FT                   /locus_tag="XBJ1_0585"
FT                   /product="putative structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0585"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79729"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79729.1"
FT                   /translation="MYDNLKSLGITHPEDIDRYSLRQEANNDILKIYFRKDKGEFFAKS
FT                   VKFKYPRQLKTISDDNSAQGYKEVKEINTNLRYVIEELDQICRHDQVEVDLKHKILDDL
FT                   RHLEHVVANKIAEIEADLEKLTRK"
     atgtacgata acttgaaaag tttggggatc acccatcctg aagatattga tcgctatagc        60
     ctccgtcagg aagcgaataa cgatattctg aagatttatt tccgtaagga taaaggcgaa       120
     ttttttgcca aaagtgttaa attcaaatat ccacgccaac tcaaaactat ctctgacgac       180
     aattcagcgc aaggttacaa agaagtcaaa gagattaaca ctaacctgcg ttatgtaatt       240
     gaagaactgg atcaaatttg caggcatgac caagtggaag tggatttgaa acacaagatc       300
     ctcgacgatc tccgccacct tgagcatgtt gttgccaata agattgcaga aattgaagcg       360
     gatttagaaa aactgactcg caagtaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page