(data stored in ACNUC1104 zone)

EMBL: FN667741.PE58

FN667741.PE58        Location/Qualifiers
FT   CDS_pept        complement(68461..69012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0013"
FT                   /locus_tag="XBJ1_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79213"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="InterPro:IPR016778"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79213.1"
FT                   /translation="MMYQVNFLPWRQARLKRLCRKWGLLLCLQLILCISVLTFISVQQK
FT                   NKIAQHHDKLTEISHQLMQLQQNIQESEHAIQHHQQLTQQLRKKQTFMEQNQRYLQLFR
FT                   QLPHLLPEKSWLTAFSDDTGQLVFAASSQNYDDVSDLLDNLTDNASLNNVQLKKMSTTE
FT                   EHLKIFTIDANWLMGAPDEK"
     atgatgtatc aggttaattt tttaccgtgg cgtcaggcaa gattaaaacg cctatgccgg        60
     aaatgggggc tattgctttg cctgcaatta atactctgca tatctgtact aacgtttatt       120
     tccgtgcagc aaaaaaacaa aattgcgcaa catcacgaca aattaacaga aattagccac       180
     caattaatgc agttacagca aaatatccaa gaaagcgaac acgctattca acatcatcag       240
     caattgacac aacaattaag gaaaaaacag acattcatgg aacagaacca aagatattta       300
     cagttatttc gtcaactccc tcatttgttg ccggaaaaaa gctggcttac tgcattcagt       360
     gacgacaccg gccaattggt ttttgccgcc agcagtcaaa actacgatga tgtctcggac       420
     ttactggata acctgaccga caatgcctca ctgaacaatg tccaactgaa aaaaatgagc       480
     accacggaag aacatctcaa gatatttact atcgatgcca attggttaat gggagcacct       540
     gatgaaaagt aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page