(data stored in ACNUC1104 zone)

EMBL: FN667741.PE595

FN667741.PE595       Location/Qualifiers
FT   CDS_pept        626350..627267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0120"
FT                   /locus_tag="XBJ1_0606"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0606"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79750"
FT                   /db_xref="GOA:D3UWH6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79750.1"
FT                   /translation="MDKYKYIIYAFSCVLIWSFVPSISRLGQKGMDHFQYLFWSNILSV
FT                   LAVFFVAVLMGRNLKQLLFIPFPVMFKVLILGTLDCFFYLLLYYGYSIENGVAVLVVQY
FT                   SWPLMIIGLSFLLLKEKLSIRQMIGITLGFIAVVITFTQGNITRIAVEHPQALLLVFSG
FT                   AFCFALMSVLSKHFAIDPYINTFWVFACSTLVSAVFLLVFSSFNWPVGDSLMPTLLNGI
FT                   ILNGVSYIIWFKAMNSPDSPKIASILFLSPVLSMIWLILFFGDAFVPAYVVGLVLVIIS
FT                   GLLCISAKTEPATQNKLSDDLIED"
     atggacaaat ataaatatat tatttacgcg ttttcctgtg tgttgatctg gagttttgtt        60
     ccctccatat cccgtttggg tcaaaaaggg atggaccatt tccaatattt gttctggtca       120
     aatattctat ccgttctggc ggttttcttt gttgctgtcc tgatgggtag aaatttgaaa       180
     caacttttat ttattccctt tccagttatg tttaaagttt tgatattagg tactctggac       240
     tgtttcttct atttattgct ctattacggt tattccatcg aaaacggcgt tgctgtcttg       300
     gtcgttcaat atagctggcc gctgatgatc atcgggttgt cgtttttact gttaaaagaa       360
     aaattgtcaa tccggcagat gattggcatc acgcttggtt ttattgccgt tgtgatcacg       420
     tttacgcaag gaaatattac ccggattgca gtagaacatc cgcaggctct gttgctggta       480
     ttcagtgggg cattttgttt tgccttgatg tctgtgttat cgaaacattt cgcgattgac       540
     ccttatataa atacattttg ggtatttgct tgttctacct tagtatcggc ggtgttttta       600
     ttggtattta gcagcttcaa ttggccagtg ggtgattcac tgatgccaac gctgctcaac       660
     ggcatcatat tgaatggcgt atcctatatt atctggttta aggctatgaa tagccctgat       720
     tcgcctaaaa ttgcctcaat cttattttta tcaccggtgt tgtcgatgat atggcttatt       780
     ctgttctttg gtgatgcatt tgtccccgct tatgttgtgg gtttagtgct tgttatcata       840
     tcggggctgc tctgcatcag tgcaaagacc gaacctgcga cacagaataa attgagtgat       900
     gatttgattg aggattga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page