(data stored in ACNUC1104 zone)

EMBL: FN667741.PE600

FN667741.PE600       Location/Qualifiers
FT   CDS_pept        complement(632183..632890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0121"
FT                   /locus_tag="XBJ1_0611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0611"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79755"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79755.1"
FT                   /translation="MADFHFTQIGTIHSPYKEKFAIPRQPGLVEDGAGQLELLAPYNQI
FT                   DAIRGIEQFSHLWIIFVFHQTMNGGWNPLVRPPRLGGNAKMGVFATRSTFRPNPIGMSL
FT                   VELKGIQCQNNRVILELGSLDLVDGTPVIDIKPYLPFAESRPEARAGFAQKAPDTGMEV
FT                   SFLPIAEHQLSSHQANYPHLRRFISQILAQDPRPAYRKKEQENRIYAVHILDFNVRWQI
FT                   RDAMTEVVSIEHR"
     atggccgatt ttcattttac tcaaatagga accatccatt ctccttataa agagaagttt        60
     gccattcccc gccaaccggg tttggtagaa gatggggcgg gacaactaga gttgctggct       120
     ccttataacc agattgatgc gatacgtggg attgaacaat tcagtcattt atggattatt       180
     tttgtttttc accaaactat gaatggtggc tggaatccat tagttcgccc accccgtttg       240
     gggggaaatg ccaaaatggg cgtgtttgct acccgctcga cattccgccc caatccgatt       300
     ggtatgtcgc tggtagaatt gaaaggtatt caatgccaga acaatcgggt catactggaa       360
     cttggcagtc tggatttagt tgatggtaca cccgttatcg atatcaagcc ctatctgcct       420
     tttgccgaat ctcgcccaga agccagagcg ggttttgcac agaaggcgcc agacaccgga       480
     atggaagtct cgttcttgcc aatagctgaa catcaactat cgtcccatca ggcaaattat       540
     cctcatttac gacgtttcat cagtcagata ttggcgcagg atcctcgccc ggcctatcgt       600
     aagaaagaac aggaaaaccg gatatatgca gttcatattc tggatttcaa tgttcgctgg       660
     cagatacgtg acgccatgac ggaagtggtt tctattgaac accgttaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page