(data stored in ACNUC1104 zone)

EMBL: FN667741.PE606

FN667741.PE606       Location/Qualifiers
FT   CDS_pept        complement(637340..638110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0123"
FT                   /locus_tag="XBJ1_0617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0617"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79761"
FT                   /db_xref="GOA:D3UWI7"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79761.1"
FT                   /translation="MIIETDRLNSACIEKLAKQEILAIRIKKFIPTSLAEKISEKILGK
FT                   GFDKYLNAPSIGRIGMAFYETENKALRVADYFENVLNNINELRQRCSPYLSPIDQLRCV
FT                   LDEVWPAGAQLETLYGKKMYVGLSRVVEPGVTFLAHHDIFAKDAPDSFRAKSLQAQFAA
FT                   NVYLSMPNEGGALQVWKNKLSPEEFDSMRRDSYGIEPSLLGKPALEVQPDAGELLIFNA
FT                   QCMHAVTAGIGSSRLSLSCFIGYRGEAAPLSFWS"
     atgattatag aaacagatcg tcttaatagc gcatgtatag aaaaacttgc taaacaagaa        60
     attttagcca tacgtataaa aaaatttatt cctacttcct tagctgaaaa aataagtgaa       120
     aaaatattag gaaaaggatt tgataaatat ttaaatgcgc cgagtatagg tcggatcggg       180
     atggcatttt acgagacaga aaataaggca ctccgtgtag cagattattt tgaaaatgtg       240
     ctcaataata tcaacgaact gaggcagcgt tgttcacctt atctatcacc aatagatcaa       300
     ctgagatgcg ttttagacga agtttggcca gcaggggctc aactcgaaac actttatggg       360
     aagaaaatgt atgtgggatt gtcaagggta gttgaacccg gagtgacttt tcttgcacat       420
     catgatattt ttgctaaaga tgctccagat agtttcagag ccaagagcct tcaggcacag       480
     tttgccgcta atgtttatct ttctatgcct aatgaaggtg gtgctttaca agtttggaaa       540
     aataaattat ctcctgaaga atttgattct atgcgcaggg atagttatgg tattgaacct       600
     tctttgcttg gaaaaccggc actagaggtt caaccggacg cgggcgaact tttgattttt       660
     aatgcccaat gtatgcacgc tgtaactgct ggtatcggta gctcacgttt aagtctgtct       720
     tgctttatag gttatcgtgg agaagcagct cctctgtcat tctggagtta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page