(data stored in ACNUC1104 zone)

EMBL: FN667741.PE608

FN667741.PE608       Location/Qualifiers
FT   CDS_pept        complement(639029..639193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0124"
FT                   /locus_tag="XBJ1_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0619"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79763"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79763.1"
FT                   /translation="MKTQWRISVLCYYSNSLLLMYIHNDRECNERIPTTVLEVRDEAWL
FT                   LTDFQPYSA"
     atgaaaacac aatggcgaat atctgttcta tgttattatt caaattcctt gttattgatg        60
     tatattcaca atgacaggga atgtaacgaa cgcatcccaa ccacagtgtt ggaagtgaga       120
     gatgaggcat ggttgctcac agatttccaa ccttatagtg cctaa                       165
//

If you have problems or comments...

PBIL Back to PBIL home page