(data stored in ACNUC1104 zone)

EMBL: FN667741.PE609

FN667741.PE609       Location/Qualifiers
FT   CDS_pept        complement(639767..639973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0620"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79764"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79764.1"
FT                   /translation="MGDPTTFRSGREFSTYLGLVPRQTGTGGRVKPVNVNGSVKLGLLL
FT                   DSSGQVQTSLRRGHICSLRLRID"
     atgggggatc cgaccacttt ccgatcaggc cgggagtttt ccacctatct gggtttggtt        60
     ccccggcaaa caggaacagg tggccgtgtt aaacctgtaa atgtcaatgg ctcagtgaag       120
     ctggggctgt tgttagattc gtcaggtcag gtgcaaacct cactaaggcg cggacacatt       180
     tgctcattga gactccggat agattga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page