(data stored in ACNUC1104 zone)

EMBL: FN667741.PE619

FN667741.PE619       Location/Qualifiers
FT   CDS_pept        complement(652443..652829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0633"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79774"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79774.1"
FT                   /translation="MGGSQALALDFSYKSEMPADNKPSEEYLKKRAGLESKSWNVDTLT
FT                   QDNVLAEKREEEMGQYNKKFENKNGIGLSYDWESKHLKSLQHMQQTSHFSNRRCYRATR
FT                   QKLEKDFGNGYSYSDIADTCGSFH"
     atgggcggta gccaagcgtt ggcactggat tttagctaca aaagtgaaat gcctgctgat        60
     aacaaacctt cagaggagta cctgaaaaaa agagcggggt tagaatccaa atcctggaat       120
     gttgatacgc tgacacagga taacgtgctg gcggagaaac gagaggaaga gatggggcag       180
     tacaacaaaa aattcgagaa taaaaatgga atcggacttt cttatgattg ggagagtaag       240
     cacctaaaat cccttcaaca tatgcaacaa acgagtcatt tctccaatcg ccgctgttac       300
     cgagctactc gacagaaatt ggaaaaagac tttggaaatg gctactctta ttcagatatt       360
     gctgatactt gtggttcttt tcactaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page