(data stored in ACNUC1104 zone)

EMBL: FN667741.PE620

FN667741.PE620       Location/Qualifiers
FT   CDS_pept        653042..653830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0634"
FT                   /product="Phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0634"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79775"
FT                   /db_xref="GOA:D3UZD2"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79775.1"
FT                   /translation="MHSYPIYHVDAFTEKSFSGNPAAVVLLDKWLTDEALIAIAAEINL
FT                   SETAFLVGNQLRWFTPKVEVNLCGHGTLATAFVLIEHQSCQDNPITFTSLSGELRVSHQ
FT                   EGIFTLDFAAADCHEEKTLVSIMQDALGQNINEVFASHDRYICVMDSADQVLNTQPDFN
FT                   KIAALPLAGLTITAPGESPVDFVSRYFAPAKGVNEDPVTGSTHCVLTPFWGKRLNKSTL
FT                   HARQLSERGGDILCKTDGNRVYLTGKAKLFSHGQILLEDQ"
     atgcattcat accctattta tcatgtcgat gctttcacgg aaaaatcctt ttctggcaac        60
     cctgccgctg ttgttttgct ggataaatgg ctgacagatg aagcgttgat tgccattgcc       120
     gcagaaatta atctttcaga gaccgccttt ctggtaggaa atcaattacg ttggtttaca       180
     cctaaagttg aagtgaattt atgtgggcat gggacgctgg caaccgcttt cgtcctcatc       240
     gaacaccaat cttgccaaga taacccgatt acgttcacaa gcctttccgg tgagcttcgt       300
     gtatctcatc aagagggtat tttcacattg gattttgccg ctgctgattg tcacgaagaa       360
     aaaacgctcg tttctattat gcaggacgct ctggggcaaa atatcaacga agtgttcgcc       420
     tcacatgatc gctatatttg cgtgatggac tctgctgatc aagttctcaa tactcaacct       480
     gacttcaata aaatcgctgc tcttccctta gctgggctta ccattaccgc tcccggtgaa       540
     tcacctgttg attttgtttc acgttatttt gctccagcaa aaggtgtcaa cgaagatcct       600
     gtgacgggtt caacccactg tgttctcacg ccattctggg gaaaaaggct caataaatca       660
     acactccatg cacggcaact ctccgaacga ggaggcgata tattatgtaa aacagacggc       720
     aatcgtgttt atttgactgg aaaagcaaaa ctcttttccc atggacaaat attgcttgaa       780
     gaccagtga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page