(data stored in ACNUC1104 zone)

EMBL: FN667741.PE7

FN667741.PE7         Location/Qualifiers
FT   CDS_pept        7006..7782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0002"
FT                   /locus_tag="XBJ1_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79162"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79162.1"
FT                   /translation="MLKRNNSFKDYISKIQSESLSRSKSFHSLPPDNILKANVNYNNPR
FT                   LINGYIPTVRETSLEEIINAVKHIYKSIKEDRWTSHIKNVTERKNEIFQKNQKTREDAW
FT                   DMRCCMTDNLLEKLQGILTILLKNGYFKTHAYFVCYINTQPIGVMLLKKYNSLYSRGTA
FT                   YYPEVNFIINHPGIQNCAYLLMEKAVNTSYKIGYQGKLKLTLATGELSSKVYQKMGFTH
FT                   IKGDENMKMELNPNGNSVWYLSPSYGGYFFTGIRRD"
     atgctaaaac gaaacaactc ctttaaggat tatatatcaa agattcaatc cgaatcttta        60
     tctcgctcaa aatctttcca ttcattacca cctgataata ttttgaaagc aaacgttaat       120
     tacaacaatc ccagattgat taatggatat attcctacag tcagagaaac cagcctagaa       180
     gagataatta atgctgttaa gcatatttac aaatcaatta aggaagacag atggactagt       240
     catattaaaa atgtgactga aagaaaaaat gaaatattcc aaaaaaatca aaaaacacgt       300
     gaagatgcat gggatatgag atgctgtatg acagataatc ttttagaaaa actacaggga       360
     attttaacca ttttattaaa aaatggttac tttaaaactc atgcttattt tgtgtgttac       420
     attaatacac aaccaatcgg agtcatgtta ttaaaaaagt ataactcttt atatagcaga       480
     ggaacagcat actatcctga ggttaatttt attatcaatc atccaggcat ccagaattgc       540
     gcctatttat tgatggaaaa agcagtaaat acttcctata aaataggtta tcaagggaaa       600
     ttaaaattga cacttgcaac aggtgaactc tcttcaaaag tttatcaaaa gatggggttt       660
     actcatatta aaggggatga gaatatgaaa atggaattaa acccaaatgg aaacagtgtc       720
     tggtatctaa gccccagtta tggcggttat ttttttacag ggatccgccg agattaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page