(data stored in ACNUC1104 zone)

EMBL: FN667741.PE70

FN667741.PE70        Location/Qualifiers
FT   CDS_pept        81989..82468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0015"
FT                   /locus_tag="XBJ1_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79225"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79225.1"
FT                   /translation="MSYMIYLTLNGKKQGLISAGCSTLDSIGNRYQKGHEDQIQVLSLN
FT                   HAISRQQNVSHQPIQFIKPIDKSSPLLAMAIDSNESLNGGFIFYRTSQTGQLELFYEVK
FT                   ITEATITDISCVYPHSINDHDMMPYEKVTLNYKSISWNHITAGTSAYIPVVIEDA"
     atgtcataca tgatatatct aacattaaat ggtaagaagc agggcttaat atcagcaggg        60
     tgttcaacgc ttgattctat aggaaatcgg tatcaaaaag ggcacgaaga tcaaatacag       120
     gtactcagcc tgaatcatgc aatttcacgc cagcagaacg tgagtcacca gccaatacag       180
     ttcatcaaac caattgacaa gtcatcacca ctactggcaa tggcaataga ctccaatgaa       240
     tcactgaatg gcggttttat tttttataga acaagccaaa cagggcaatt agaattattc       300
     tacgaagtaa aaattacgga agccactatc acagatatct cctgtgtata cccacattct       360
     ataaatgatc acgatatgat gccatatgaa aaagttacat taaactataa atctatatca       420
     tggaatcata taacggcagg tacatctgcc tatatacccg tcgtcattga agatgcttga       480
//

If you have problems or comments...

PBIL Back to PBIL home page