(data stored in ACNUC1104 zone)

EMBL: FN667741.PE76

FN667741.PE76        Location/Qualifiers
FT   CDS_pept        86667..87440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0016"
FT                   /locus_tag="XBJ1_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79231"
FT                   /db_xref="GOA:D3UY53"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79231.1"
FT                   /translation="MVQNRSSRDLVSRAHHELFTDRDVRALERYFAPNFIEHSPLVKEG
FT                   FAGLRERVQAHPELHHEMYRVLQDGDLVAIHGRFTGLDEQPLVGFDLYRVADGLIVEHW
FT                   DGLVPQSAPNTSGRTQLDGPTETGYSHDREKNRELVVNFFTRTLIEEHYDEFGNYTNGE
FT                   EFRQHSPDIPDGTVAVIEFLKQLKDEGQGLHYAKIHHTVADGQFVLSHSEGSIAGVRHS
FT                   YFELWRIENGKVAELWDAITPVPEDAQALHRHGMF"
     atggttcaaa atagatcttc acgtgacttg gtatcgcgtg cgcaccacga gctgtttact        60
     gatcgtgatg tgagggcgct tgaacgttat tttgcgccaa atttcatcga acattctccg       120
     ttggttaaag aggggttcgc cggattgcgt gagcgggttc aggcacatcc tgaactgcac       180
     catgaaatgt atcgcgtact acaggatggt gacttagttg ctattcacgg ccgttttacg       240
     ggattagatg agcagccgtt ggtcggtttc gatctgtacc gggttgccga tggtttaatt       300
     gtggagcact gggacggctt agtgccgcag tccgcgccca acaccagtgg ccgaactcag       360
     ttagacggcc cgactgaaac gggctatagc catgacagag agaagaaccg cgagctggtg       420
     gttaactttt tcacccgtac cctgatcgaa gaacactatg atgagtttgg aaactacacc       480
     aatggtgaag agtttcgtca acacagcccg gatattcctg atggtacggt tgcggtcatt       540
     gagtttctta agcaactcaa ggatgaaggg cagggcctgc attatgccaa aatccaccat       600
     acagtcgccg acgggcagtt tgttctgagc cactcggagg gaagtattgc cggagtacgt       660
     cacagctact ttgagctatg gcgcattgag aacggcaaag tggctgagct ttgggatgct       720
     atcacaccgg taccggagga tgcgcaagcg ctgcatcgcc acggtatgtt ttaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page