(data stored in ACNUC1104 zone)

EMBL: FN667741.PE78

FN667741.PE78        Location/Qualifiers
FT   CDS_pept        88286..89035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0016"
FT                   /locus_tag="XBJ1_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79233"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79233.1"
FT                   /translation="MYNDIHVERARSILNDILVTAQQATAALADKTARILLELPLCHTV
FT                   GVRLAREQRGALQKHIHDVLRNNVWCNGAGFASYAVPKTVGKEGYWTLEWWRQEGDTIQ
FT                   YAPLEHNQEQRRRLDFRLFEWFRQPANCHLPVIDGPYVDYVCNGAYTITIAHPVLIGEE
FT                   FAGVAAVDMLVSTLDRLLLPALGAIGKPALIINDDARVVTSTVPGVRSGSLLKSQGVNR
FT                   SVDGEVPSLRLVILPSSHTESHRAFVC"
     atgtacaacg atatacacgt agaacgggcc aggagcatcc tgaacgatat tctggtcacg        60
     gcgcagcagg ccaccgcagc tctagcggat aagacagcgc gtattttatt ggaactgccg       120
     ttatgtcata cggtaggtgt ccgcttggcg cgggagcaac gcggcgcatt gcaaaaacat       180
     atccacgatg tactgcgtaa taacgtctgg tgtaacgggg cgggatttgc cagttatgca       240
     gtcccgaaga cggttgggaa ggagggatac tggacgctgg agtggtggcg tcaggaaggg       300
     gataccattc aatatgcgcc actggaacac aatcaggagc agcgcaggcg cctggatttc       360
     cggttgtttg agtggttcag gcagccggcc aactgtcatc ttcccgtcat tgacggcccc       420
     tatgtggatt atgtctgtaa cggtgcctac acaattacga tagcccatcc ggtgcttatc       480
     ggtgaggaat ttgccggtgt tgcggcggtg gatatgctgg tctcgacgct ggatcggtta       540
     cttctgccgg ctctgggcgc tatcggtaag ccagcattga ttattaatga cgatgcgcgt       600
     gtcgtgacct cgacagtgcc gggagtgcgt tcaggttcgc tattgaagag ccaaggcgtt       660
     aaccggtcgg tcgatggtga agtcccttca ctgcgtctgg taattttgcc gtcatcacac       720
     actgaatcac acagggcatt tgtctgctga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page